UniProt ID | PILRB_HUMAN | |
---|---|---|
UniProt AC | Q9UKJ0 | |
Protein Name | Paired immunoglobulin-like type 2 receptor beta | |
Gene Name | PILRB | |
Organism | Homo sapiens (Human). | |
Sequence Length | 227 | |
Subcellular Localization |
Membrane Single-pass type I membrane protein . |
|
Protein Description | Paired receptors consist of highly related activating and inhibitory receptors and are widely involved in the regulation of the immune system. PILRB is thought to act as a cellular signaling activating receptor that associates with ITAM-bearing adapter molecules on the cell surface.. | |
Protein Sequence | MGRPLLLPLLLLLQPPAFLQPGGSTGSGPSYLYGVTQPKHLSASMGGSVEIPFSFYYPWELAIVPNVRISWRRGHFHGQSFYSTRPPSIHKDYVNRLFLNWTEGQESGFLRISNLRKEDQSVYFCRVELDTRRSGRQQLQSIKGTKLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALAVAVLKTVILGLLCLLLLWWRRRKGSRAPSSDF | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
24 (in isoform 3) | Phosphorylation | - | 35.19 | 23927012 | |
24 | Phosphorylation | AFLQPGGSTGSGPSY CCCCCCCCCCCCCCC | 35.19 | 24043423 | |
25 | Phosphorylation | FLQPGGSTGSGPSYL CCCCCCCCCCCCCCE | 38.35 | 24043423 | |
27 (in isoform 3) | Phosphorylation | - | 47.85 | 23927012 | |
27 | Phosphorylation | QPGGSTGSGPSYLYG CCCCCCCCCCCCEEE | 47.85 | 24043423 | |
30 | Phosphorylation | GSTGSGPSYLYGVTQ CCCCCCCCCEEEECC | 31.15 | 24043423 | |
31 | Phosphorylation | STGSGPSYLYGVTQP CCCCCCCCEEEECCC | 13.69 | 24043423 | |
33 | Phosphorylation | GSGPSYLYGVTQPKH CCCCCCEEEECCCCE | 11.00 | 24043423 | |
36 | Phosphorylation | PSYLYGVTQPKHLSA CCCEEEECCCCEEEC | 34.49 | 24043423 | |
45 (in isoform 3) | Phosphorylation | - | 7.63 | 30631047 | |
70 | Phosphorylation | IVPNVRISWRRGHFH EECCEEEEEECCCCC | 12.17 | 24719451 | |
81 (in isoform 3) | Phosphorylation | - | 4.25 | 22617229 | |
83 | Phosphorylation | FHGQSFYSTRPPSIH CCCCCCCCCCCCCCC | 18.87 | - | |
84 | Phosphorylation | HGQSFYSTRPPSIHK CCCCCCCCCCCCCCH | 35.50 | - | |
88 | Phosphorylation | FYSTRPPSIHKDYVN CCCCCCCCCCHHHHH | 39.75 | - | |
100 | N-linked_Glycosylation | YVNRLFLNWTEGQES HHHHHCCCCCCCCCC | 35.97 | UniProtKB CARBOHYD | |
113 | Phosphorylation | ESGFLRISNLRKEDQ CCCEEEEECCCHHCC | 24.31 | 24719451 | |
121 | Phosphorylation | NLRKEDQSVYFCRVE CCCHHCCEEEEEEEE | 30.98 | 22210691 | |
141 | Phosphorylation | SGRQQLQSIKGTKLT CHHHHHHHCCCCEEE | 34.56 | 29083192 | |
145 | Phosphorylation | QLQSIKGTKLTITQA HHHHCCCCEEEEEEE | 20.20 | 29083192 | |
148 | Phosphorylation | SIKGTKLTITQAVTT HCCCCEEEEEEEEEE | 24.43 | - | |
156 | Phosphorylation | ITQAVTTTTTWRPSS EEEEEEECCEECCCC | 16.92 | - | |
157 | Phosphorylation | TQAVTTTTTWRPSST EEEEEECCEECCCCC | 23.44 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PILRB_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PILRB_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PILRB_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PILRB_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...