UniProt ID | PIHD1_MOUSE | |
---|---|---|
UniProt AC | Q9CQJ2 | |
Protein Name | PIH1 domain-containing protein 1 | |
Gene Name | Pih1d1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 290 | |
Subcellular Localization | ||
Protein Description | Involved in the assembly of C/D box small nucleolar ribonucleoprotein (snoRNP) particles. Recruits the SWI/SNF complex to the core promoter of rRNA genes and enhances pre-rRNA transcription. Mediates interaction of TELO2 with the R2TP complex which is necessary for the stability of MTOR and SMG1. Positively regulates the assembly and activity of the mTORC1 complex.. | |
Protein Sequence | MADSTFLAPELSDTESMGEETVRFQELLLKASKELQQAQTARPDSTQIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNIRSQQRPRIQELGTLDASGSLGTCHGPERPHLNLWLEAPDLLLAEVDLPKLDGAQGLALEIGENRLVIGGPQQLYHLDATVPLRINSEASRAAFHRRRKQLMVSMPLLTASS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | Phosphorylation | ----MADSTFLAPEL ----CCCCCCCCCCC | 16.12 | 21149613 | |
5 | Phosphorylation | ---MADSTFLAPELS ---CCCCCCCCCCCC | 24.18 | 21149613 | |
12 | Phosphorylation | TFLAPELSDTESMGE CCCCCCCCCCCCCCH | 40.60 | 26824392 | |
14 | Phosphorylation | LAPELSDTESMGEET CCCCCCCCCCCCHHH | 26.95 | 24068923 | |
16 | Phosphorylation | PELSDTESMGEETVR CCCCCCCCCCHHHHH | 33.89 | 24068923 | |
21 | Phosphorylation | TESMGEETVRFQELL CCCCCHHHHHHHHHH | 16.81 | 26643407 | |
51 | Acetylation | DSTQIQPKPGFCVKT CCCCCCCCCCEEEEE | 41.20 | 22826441 | |
173 | Phosphorylation | KYRSFLGSISQQNIR HHHHHHHHHHHHHHH | 22.63 | 25338131 | |
175 | Phosphorylation | RSFLGSISQQNIRSQ HHHHHHHHHHHHHHC | 27.66 | 27841257 | |
290 | Phosphorylation | MPLLTASS------- CCEEECCC------- | 41.60 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIHD1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIHD1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIHD1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
TELO2_MOUSE | Telo2 | physical | 24794838 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...