PIHD1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PIHD1_MOUSE
• UniProt AC: Q9CQJ2
• Protein Name: PIH1 domain-containing protein 1
• Gene Name: Pih1d1
• Organism: Mus musculus (Mouse).
• Sequence Length: 290
• Protein Description: Involved in the assembly of C/D box small nucleolar ribonucleoprotein (snoRNP) particles. Recruits the SWI/SNF complex to the core promoter of rRNA genes and enhances pre-rRNA transcription. Mediates interaction of TELO2 with the R2TP complex which is necessary for the stability of MTOR and SMG1. Positively regulates the assembly and activity of the mTORC1 complex..
• Protein Sequence: MADSTFLAPELSDTESMGEETVRFQELLLKASKELQQAQTARPDSTQIQPKPGFCVKTNSSEGKVFINICHSPSIPPPADVTEDELLQMLEEDQAGFRIPMSLGEPHAELDAKGQGCTAYDVAVNSNFYLRMQNSDFLRELVVTIAREGLEDKYGLQLNPEWRMLKYRSFLGSISQQNIRSQQRPRIQELGTLDASGSLGTCHGPERPHLNLWLEAPDLLLAEVDLPKLDGAQGLALEIGENRLVIGGPQQLYHLDATVPLRINSEASRAAFHRRRKQLMVSMPLLTASS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
4	Phosphorylation	----MADSTFLAPEL ----CCCCCCCCCCC	16.12	21149613
5	Phosphorylation	---MADSTFLAPELS ---CCCCCCCCCCCC	24.18	21149613
12	Phosphorylation	TFLAPELSDTESMGE CCCCCCCCCCCCCCH	40.60	26824392
14	Phosphorylation	LAPELSDTESMGEET CCCCCCCCCCCCHHH	26.95	24068923
16	Phosphorylation	PELSDTESMGEETVR CCCCCCCCCCHHHHH	33.89	24068923
21	Phosphorylation	TESMGEETVRFQELL CCCCCHHHHHHHHHH	16.81	26643407
51	Acetylation	DSTQIQPKPGFCVKT CCCCCCCCCCEEEEE	41.20	22826441
173	Phosphorylation	KYRSFLGSISQQNIR HHHHHHHHHHHHHHH	22.63	25338131
175	Phosphorylation	RSFLGSISQQNIRSQ HHHHHHHHHHHHHHC	27.66	27841257
290	Phosphorylation	MPLLTASS------- CCEEECCC-------	41.60	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PIHD1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PIHD1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PIHD1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
TELO2_MOUSE	Telo2	physical	24794838

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.