| UniProt ID | PIGX_HUMAN | |
|---|---|---|
| UniProt AC | Q8TBF5 | |
| Protein Name | Phosphatidylinositol-glycan biosynthesis class X protein | |
| Gene Name | PIGX | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 258 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. |
|
| Protein Description | Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM (By similarity).. | |
| Protein Sequence | MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 31 | O-linked_Glycosylation | RGPAAAFTAARSDAG CCHHHHHHHHHCHHH | 18.06 | 55831501 | |
| 54 | Ubiquitination | ILRQEVLKDGFHRDL HHCHHHHHCCCCCCE | 62.06 | - | |
| 66 | Ubiquitination | RDLLIKVKFGESIED CCEEEEEECCCCHHH | 42.52 | 29967540 | |
| 82 | Ubiquitination | HTCRLLIKQDIPAGL HHHEEEEECCCCCCC | 41.72 | 21963094 | |
| 82 (in isoform 1) | Ubiquitination | - | 41.72 | 21906983 | |
| 82 (in isoform 2) | Ubiquitination | - | 41.72 | 21906983 | |
| 98 | Phosphorylation | VDPYELASLRERNIT CCHHHHHHHHHCCCC | 40.35 | 24719451 | |
| 103 | N-linked_Glycosylation | LASLRERNITEAVMV HHHHHHCCCCEEEEE | 40.56 | UniProtKB CARBOHYD | |
| 111 | Phosphorylation | ITEAVMVSENFDIEA CCEEEEECCCCCCCC | 14.55 | 25693802 | |
| 136 | Phosphorylation | LIYARRDSQCIDCFQ EEEECCCCHHHHHHH | 25.74 | 27080861 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIGX_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIGX_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIGX_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PIGX_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
