UniProt ID | PIGX_HUMAN | |
---|---|---|
UniProt AC | Q8TBF5 | |
Protein Name | Phosphatidylinositol-glycan biosynthesis class X protein | |
Gene Name | PIGX | |
Organism | Homo sapiens (Human). | |
Sequence Length | 258 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein. |
|
Protein Description | Essential component of glycosylphosphatidylinositol-mannosyltransferase 1 which transfers the first of the 4 mannoses in the GPI-anchor precursors during GPI-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM (By similarity).. | |
Protein Sequence | MAARVAAVRAAAWLLLGAATGLTRGPAAAFTAARSDAGIRAMCSEIILRQEVLKDGFHRDLLIKVKFGESIEDLHTCRLLIKQDIPAGLYVDPYELASLRERNITEAVMVSENFDIEAPNYLSKESEVLIYARRDSQCIDCFQAFLPVHCRYHRPHSEDGEASIVVNNPDLLMFCDQEFPILKCWAHSEVAAPCALENEDICQWNKMKYKSVYKNVILQVPVGLTVHTSLVCSVTLLITILCSTLILVAVFKYGHFSL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
31 | O-linked_Glycosylation | RGPAAAFTAARSDAG CCHHHHHHHHHCHHH | 18.06 | 55831501 | |
54 | Ubiquitination | ILRQEVLKDGFHRDL HHCHHHHHCCCCCCE | 62.06 | - | |
66 | Ubiquitination | RDLLIKVKFGESIED CCEEEEEECCCCHHH | 42.52 | 29967540 | |
82 | Ubiquitination | HTCRLLIKQDIPAGL HHHEEEEECCCCCCC | 41.72 | 21963094 | |
82 (in isoform 1) | Ubiquitination | - | 41.72 | 21906983 | |
82 (in isoform 2) | Ubiquitination | - | 41.72 | 21906983 | |
98 | Phosphorylation | VDPYELASLRERNIT CCHHHHHHHHHCCCC | 40.35 | 24719451 | |
103 | N-linked_Glycosylation | LASLRERNITEAVMV HHHHHHCCCCEEEEE | 40.56 | UniProtKB CARBOHYD | |
111 | Phosphorylation | ITEAVMVSENFDIEA CCEEEEECCCCCCCC | 14.55 | 25693802 | |
136 | Phosphorylation | LIYARRDSQCIDCFQ EEEECCCCHHHHHHH | 25.74 | 27080861 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIGX_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIGX_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIGX_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PIGX_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...