dbPTM

PIGC_HUMAN - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PIGC_HUMAN
UniProt AC	Q92535
Protein Name	Phosphatidylinositol N-acetylglucosaminyltransferase subunit C
Gene Name	PIGC
Organism	Homo sapiens (Human).
Sequence Length	297
Subcellular Localization	Endoplasmic reticulum membrane Multi-pass membrane protein .
Protein Description	Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis..
Protein Sequence	MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Phosphorylation	------MYAQPVTNT ------CCCCCCCCC	17.59	27642862
10	Ubiquitination	AQPVTNTKEVKWQKV CCCCCCCCCEEEEEE	63.68	-
16	Ubiquitination	TKEVKWQKVLYERQP CCCEEEEEEHHCCCC	32.85	29967540
218	Acetylation	ALWPMLQKKLKACTP HHHHHHHHHHHCCCC	56.99	19667041
221	Acetylation	PMLQKKLKACTPRSY HHHHHHHHCCCCHHH	50.74	19667049
221	Ubiquitination	PMLQKKLKACTPRSY HHHHHHHHCCCCHHH	50.74	27667366
289	Ubiquitination	PWDEAEIKEDLSRFL CCCHHHHHHHHHHHH	36.36	29967540

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PIGC_HUMAN !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PIGC_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PIGC_HUMAN !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
ZHX1_HUMAN	ZHX1	physical	16169070

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PIGC_HUMAN

Related Literatures of Post-Translational Modification