UniProt ID | PIGC_HUMAN | |
---|---|---|
UniProt AC | Q92535 | |
Protein Name | Phosphatidylinositol N-acetylglucosaminyltransferase subunit C | |
Gene Name | PIGC | |
Organism | Homo sapiens (Human). | |
Sequence Length | 297 | |
Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
Protein Description | Part of the complex catalyzing the transfer of N-acetylglucosamine from UDP-N-acetylglucosamine to phosphatidylinositol, the first step of GPI biosynthesis.. | |
Protein Sequence | MYAQPVTNTKEVKWQKVLYERQPFPDNYVDRRFLEELRKNIHARKYQYWAVVFESSVVIQQLCSVCVFVVIWWYMDEGLLAPHWLLGTGLASSLIGYVLFDLIDGGEGRKKSGQTRWADLKSALVFITFTYGFSPVLKTLTESVSTDTIYAMSVFMLLGHLIFFDYGANAAIVSSTLSLNMAIFASVCLASRLPRSLHAFIMVTFAIQIFALWPMLQKKLKACTPRSYVGVTLLFAFSAVGGLLSISAVGAVLFALLLMSISCLCPFYLIRLQLFKENIHGPWDEAEIKEDLSRFLS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Phosphorylation | ------MYAQPVTNT ------CCCCCCCCC | 17.59 | 27642862 | |
10 | Ubiquitination | AQPVTNTKEVKWQKV CCCCCCCCCEEEEEE | 63.68 | - | |
16 | Ubiquitination | TKEVKWQKVLYERQP CCCEEEEEEHHCCCC | 32.85 | 29967540 | |
218 | Acetylation | ALWPMLQKKLKACTP HHHHHHHHHHHCCCC | 56.99 | 19667041 | |
221 | Acetylation | PMLQKKLKACTPRSY HHHHHHHHCCCCHHH | 50.74 | 19667049 | |
221 | Ubiquitination | PMLQKKLKACTPRSY HHHHHHHHCCCCHHH | 50.74 | 27667366 | |
289 | Ubiquitination | PWDEAEIKEDLSRFL CCCHHHHHHHHHHHH | 36.36 | 29967540 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PIGC_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PIGC_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PIGC_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
ZHX1_HUMAN | ZHX1 | physical | 16169070 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...