dbPTM

PI5L1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PI5L1_MOUSE
UniProt AC	Q6U7H8
Protein Name	Phosphatidylinositol 4-phosphate 5-kinase-like protein 1
Gene Name	Pip5kl1
Organism	Mus musculus (Mouse).
Sequence Length	395
Subcellular Localization	Cytoplasm . Membrane . Localized to large cytoplasmic vesicular structures.
Protein Description	May act as a scaffold to localize and regulate type I PI(4)P 5-kinases to specific compartments within the cell, where they generate PI(4,5)P2 for actin nucleation, signaling and scaffold protein recruitment and conversion to PI(3,4,5)P3..
Protein Sequence	MATPSLRSHEIPAHSQEAGNKSISSGSRRGLLWHLRARQSRVGLFEVGPGHELHRMTRMMQEGLWAATQVSKNNPPTGPTTQKDYLEVMTQVHEEGFELGTLAGPAFARLRKSIGLTEEDYQATLGPGDPYLQFFSTSKSKASFFLTHDQRFFVKTQRRHEVHVLLAHLPRYVEHLQQYPHSLLARLLGVYSLRVAQGKKKYFIIMQCIFYPTSRISERYDIKGCNISRWVDPAPEGSPLVLVLKDLNFQEKTMRLGAQRSWFLRQMELDTAFLREVNVLDYSLLVAIQFLHEDEKGIHHSVFSTFKSIQGVSKSKGTGDQNCRMLPDLPNALHILDGPDQRYFLGLVDMTTVYGFRKRLEHVWKMVRYPGQSVSTVSPAHYARRLCRWAEVHTE

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
124	Phosphorylation	TEEDYQATLGPGDPY CHHHHHHHCCCCCCC	19.40	22871156
140	Phosphorylation	QFFSTSKSKASFFLT HEEECCCCCCEEEEE	32.97	22871156
343	Phosphorylation	LDGPDQRYFLGLVDM CCCCCCCEEECCCCC	9.49	27357545
352	Phosphorylation	LGLVDMTTVYGFRKR ECCCCCHHHHCHHHH	12.70	27357545
354	Phosphorylation	LVDMTTVYGFRKRLE CCCCHHHHCHHHHHH	14.41	27357545

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PI5L1_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PI5L1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PI5L1_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PI5L1_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PI5L1_MOUSE

Related Literatures of Post-Translational Modification