| UniProt ID | PHYIP_RAT | |
|---|---|---|
| UniProt AC | Q568Z9 | |
| Protein Name | Phytanoyl-CoA hydroxylase-interacting protein | |
| Gene Name | Phyhip | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 330 | |
| Subcellular Localization | ||
| Protein Description | Its interaction with PHYH suggests a role in the development of the central system.. | |
| Protein Sequence | MELLSTPHSIEINNITCDSFRISWAMEDSDLERVTHYFIDLNKKENKNSNKFKHRDVPTKLVAKAVPLPMTVRGHWFLSPRTEYSVAVQTAVKQSDGEYLVSGWSETVEFCTGDYAKEHLAQLQEKAEQIAGRMLRFSVFYRNHHKEYFQHARTHCGNVLQPYLKDNSGSHGSPTSGMLHGVFFSCNTEFNTGQPPQDSPYGRWRFQIPAQRLFNPSTNLYFADFYCMYTAYHYAILVLAPKGSLGDRFCRDRLPLLDIACNKFLTCSVEDGELIFRHAQDLILEIIYTEPVDLSLGTLGEISGHQLMSLSTADAKKDPSCKTCNISVGR | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 5 | Phosphorylation | ---MELLSTPHSIEI ---CCCCCCCCEEEE | 53.14 | 16641100 | |
| 6 | Phosphorylation | --MELLSTPHSIEIN --CCCCCCCCEEEEC | 25.62 | 16641100 | |
| 9 | Phosphorylation | ELLSTPHSIEINNIT CCCCCCCEEEECCEE | 24.10 | 16641100 | |
| 14 | N-linked_Glycosylation | PHSIEINNITCDSFR CCEEEECCEEECEEE | 36.29 | - | |
| 16 | Phosphorylation | SIEINNITCDSFRIS EEEECCEEECEEEEE | 16.63 | 16641100 | |
| 19 | Phosphorylation | INNITCDSFRISWAM ECCEEECEEEEEEEC | 20.69 | 16641100 | |
| 43 | Acetylation | HYFIDLNKKENKNSN EEEEECCCCCCCCCC | 69.62 | 22902405 | |
| 64 | Ubiquitination | VPTKLVAKAVPLPMT CCHHHHEEEECCCEE | 42.30 | - | |
| 79 | Phosphorylation | VRGHWFLSPRTEYSV EECEEEECCCCEEEE | 11.67 | 22673903 | |
| 126 | Ubiquitination | HLAQLQEKAEQIAGR HHHHHHHHHHHHHHH | 44.24 | - | |
| 322 | Ubiquitination | AKKDPSCKTCNISVG CCCCCCCCCCCCEEC | 61.52 | - | |
| 325 | N-linked_Glycosylation | DPSCKTCNISVGR-- CCCCCCCCCEECC-- | 34.50 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHYIP_RAT !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHYIP_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHYIP_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PHYIP_RAT !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
