| UniProt ID | PHOCN_MOUSE | |
|---|---|---|
| UniProt AC | Q6PEB6 | |
| Protein Name | MOB-like protein phocein | |
| Gene Name | Mob4 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 225 | |
| Subcellular Localization |
Cytoplasm, perinuclear region . Membrane Peripheral membrane protein . Golgi apparatus, Golgi stack membrane Peripheral membrane protein . In a perinuclear punctate pattern. Associated with membranes and the Golgi stacks. |
|
| Protein Description | May play a role in membrane trafficking, specifically in membrane budding reactions.. | |
| Protein Sequence | MVMAEGTAVLRRNRPGTKAQDFYNWPDESFDEMDSTLAVQQYIQQNIRADCSNIDKILEPPEGQDEGVWKYEHLRQFCLELNGLAVKLQSECHPDTCTQMTATEQWIFLCAAHKTPKECPAIDYTRHTLDGAACLLNSNKYFPSRVSIKESSVAKLGSVCRRIYRIFSHAYFHHRQIFDEYENETFLCHRFTKFVMKYNLMSKDNLIVPILEEEVQNSVSGESEA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 119 | S-nitrosocysteine | AHKTPKECPAIDYTR HCCCCCCCCCCCCCC | 3.26 | - | |
| 134 | S-nitrosocysteine | HTLDGAACLLNSNKY CCCCHHHHHHCCCCC | 4.38 | - | |
| 140 | Malonylation | ACLLNSNKYFPSRVS HHHHCCCCCCCCCEE | 48.35 | 26320211 | |
| 140 | Acetylation | ACLLNSNKYFPSRVS HHHHCCCCCCCCCEE | 48.35 | 23236377 | |
| 141 | Phosphorylation | CLLNSNKYFPSRVSI HHHCCCCCCCCCEEE | 25.60 | 29514104 | |
| 144 | Phosphorylation | NSNKYFPSRVSIKES CCCCCCCCCEEECHH | 35.10 | 23984901 | |
| 147 | Phosphorylation | KYFPSRVSIKESSVA CCCCCCEEECHHHHH | 27.17 | 26643407 | |
| 155 | Malonylation | IKESSVAKLGSVCRR ECHHHHHHHHHHHHH | 51.75 | 26320211 | |
| 218 | Phosphorylation | LEEEVQNSVSGESEA CHHHHHHHCCCCCCC | 10.68 | 21743459 | |
| 220 | Phosphorylation | EEVQNSVSGESEA-- HHHHHHCCCCCCC-- | 36.34 | 21743459 | |
| 223 | Phosphorylation | QNSVSGESEA----- HHHCCCCCCC----- | 42.20 | 21743459 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHOCN_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHOCN_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHOCN_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PHOCN_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
