PHF5A_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PHF5A_MOUSE
• UniProt AC: P83870
• Protein Name: PHD finger-like domain-containing protein 5A
• Gene Name: Phf5a
• Organism: Mus musculus (Mouse).
• Sequence Length: 110
• Subcellular Localization: Nucleus . Nucleus speckle .
• Protein Description: Involved with the PAF1 complex (PAF1C) in transcriptional elongation by RNA polymerase II, and in regulation of development and maintenance of embryonic stem cell (ESC) pluripotency. Required for maintenance of ESCs self-renewal and cellular reprogramming of stem cells. Maintains pluripotency by recruiting and stabilizing PAF1C on pluripotency genes loci, and by regulating the expression of the pluripotency genes. Regulates the deposition of elongation-associated histone modifications, including dimethylated histone H3 'Lys-79' (H3K79me2) and trimethylated histone H3 'Lys-36' (H3K36me3), on PAF1C targets, self-renewal and pluripotency genes. Regulates RNA polymerase II promoter-proximal pause release of the PAF1C targets and self-renewal genes, and the levels of elongating ('Ser-2' phosphorylated) RNA polymerase II in their gene bodies. Regulates muscle specification in adult stem cells by stabilizing PAF1C in chromatin to promote myogenic differentiation. [PubMed: 27749823 Involved in pre-mRNA splicing as a component of the splicing factor SF3B complex. SF3B complex is required for 'A' complex assembly formed by the stable binding of U2 snRNP to the branchpoint sequence (BPS) in pre-mRNA. Sequence independent binding of SF3A/SF3B complex upstream of the branch site is essential, it may anchor U2 snRNP to the pre-mRNA (By similarity Acts as a transcriptional regulator by binding to the GJA1/Cx43 promoter and enhancing its up-regulation by ESR1/ER-alpha (By similarity]
• Protein Sequence: MAKHHPDLIFCRKQAGVAIGRLCEKCDGKCVICDSYVRPCTLVRICDECNYGSYQGRCVICGGPGVSDAYYCKECTIQEKDRDGCPKIVNLGSSKTDLFYERKKYGFKKR

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAKHHPDLI ------CCCCCCCEE	21.64	23806337
3	Acetylation	-----MAKHHPDLIF -----CCCCCCCEEE	40.94	23806337
73	Ubiquitination	VSDAYYCKECTIQEK CCCEEEEECCCCCEE	39.44	-
93	Phosphorylation	PKIVNLGSSKTDLFY CCEEEECCCCHHHHH	31.65	19060867
94	Phosphorylation	KIVNLGSSKTDLFYE CEEEECCCCHHHHHH	37.46	30352176
95	Ubiquitination	IVNLGSSKTDLFYER EEEECCCCHHHHHHH	47.99	22790023
96	Phosphorylation	VNLGSSKTDLFYERK EEECCCCHHHHHHHH	39.62	21082442
100	Phosphorylation	SSKTDLFYERKKYGF CCCHHHHHHHHHHCC	23.32	29514104

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PHF5A_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PHF5A_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PHF5A_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of PHF5A_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.