UniProt ID | PHB_RAT | |
---|---|---|
UniProt AC | P67779 | |
Protein Name | Prohibitin | |
Gene Name | Phb | |
Organism | Rattus norvegicus (Rat). | |
Sequence Length | 272 | |
Subcellular Localization | Mitochondrion inner membrane . | |
Protein Description | Prohibitin inhibits DNA synthesis. It has a role in regulating proliferation. As yet it is unclear if the protein or the mRNA exhibits this effect. May play a role in regulating mitochondrial respiration activity and in aging.. | |
Protein Sequence | MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIYTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAKVFESI ------CCHHHHHHH | 18.91 | - | |
4 | Acetylation | ----MAAKVFESIGK ----CCHHHHHHHHH | 37.61 | 22902405 | |
83 | Acetylation | VPVITGSKDLQNVNI CCEEECCCCHHCCCE | 64.90 | 22902405 | |
91 | Phosphorylation | DLQNVNITLRILFRP CHHCCCEEEHHHHHH | 12.55 | 30181290 | |
101 | O-linked_Glycosylation | ILFRPVASQLPRIYT HHHHHHHHCCCCEEH | 32.27 | 27213235 | |
101 | Phosphorylation | ILFRPVASQLPRIYT HHHHHHHHCCCCEEH | 32.27 | 23984901 | |
107 | Phosphorylation | ASQLPRIYTSIGEDY HHCCCCEEHHCCCCC | 8.84 | 23991683 | |
108 | Phosphorylation | SQLPRIYTSIGEDYD HCCCCEEHHCCCCCC | 16.11 | 23991683 | |
109 | Phosphorylation | QLPRIYTSIGEDYDE CCCCEEHHCCCCCCC | 16.18 | 23991683 | |
121 | O-linked_Glycosylation | YDERVLPSITTEILK CCCCCCCHHHHHHHH | 28.53 | 27213235 | |
121 | Phosphorylation | YDERVLPSITTEILK CCCCCCCHHHHHHHH | 28.53 | 23991683 | |
123 | Phosphorylation | ERVLPSITTEILKSV CCCCCHHHHHHHHHH | 23.78 | 23991683 | |
124 | Phosphorylation | RVLPSITTEILKSVV CCCCHHHHHHHHHHH | 21.25 | 23991683 | |
128 | Succinylation | SITTEILKSVVARFD HHHHHHHHHHHHHCC | 47.03 | 26843850 | |
128 | Acetylation | SITTEILKSVVARFD HHHHHHHHHHHHHCC | 47.03 | 22902405 | |
151 | Phosphorylation | ELVSRQVSDDLTERA HHHHHHCCCHHHHHH | 19.64 | 23991683 | |
155 | Phosphorylation | RQVSDDLTERAATFG HHCCCHHHHHHHHHC | 30.35 | 30181290 | |
186 | Acetylation | FTEAVEAKQVAQQEA HHHHHHHHHHHHHHH | 31.62 | 22902405 | |
202 | Succinylation | RARFVVEKAEQQKKA HHHHHHHHHHHHHHE | 45.68 | - | |
202 | Succinylation | RARFVVEKAEQQKKA HHHHHHHHHHHHHHE | 45.68 | - | |
202 | Acetylation | RARFVVEKAEQQKKA HHHHHHHHHHHHHHE | 45.68 | 25786129 | |
207 | Acetylation | VEKAEQQKKAAIISA HHHHHHHHHEEEEEC | 44.04 | 22902405 | |
213 | Phosphorylation | QKKAAIISAEGDSKA HHHEEEEECCCCHHH | 17.72 | 30181290 | |
218 | Phosphorylation | IISAEGDSKAAELIA EEECCCCHHHHHHHH | 34.74 | 23984901 | |
240 | Succinylation | DGLIELRKLEAAEDI CCHHHHHHHHHHHHH | 64.40 | 26843850 | |
249 | Phosphorylation | EAAEDIAYQLSRSRN HHHHHHHHHHHCCCC | 15.43 | 23991683 | |
252 | Phosphorylation | EDIAYQLSRSRNITY HHHHHHHHCCCCCEE | 16.82 | 23991683 | |
258 | Phosphorylation | LSRSRNITYLPAGQS HHCCCCCEEECCCCE | 23.66 | 25575281 | |
259 | Phosphorylation | SRSRNITYLPAGQSV HCCCCCEEECCCCEE | 13.59 | 25575281 | |
265 | Phosphorylation | TYLPAGQSVLLQLPQ EEECCCCEEEECCCC | 17.51 | 25575281 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PHB_RAT !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PHB_RAT !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PHB_RAT !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PHB_RAT !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...