PGRC1_RAT - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PGRC1_RAT
• UniProt AC: P70580
• Protein Name: Membrane-associated progesterone receptor component 1
• Gene Name: Pgrmc1 {ECO:0000312|RGD:70890}
• Organism: Rattus norvegicus (Rat).
• Sequence Length: 195
• Subcellular Localization: Microsome membrane ; Single-pass membrane protein . Smooth endoplasmic reticulum membrane ; Single-pass membrane protein .
• Protein Description: Component of a progesterone-binding protein complex. Binds progesterone. Has many reported cellular functions (heme homeostasis, interaction with CYPs). May be implicated in 2,3,7,8-tetrachlorodibenzo-p-dioxin (TCDD) immunotoxicity. [PubMed: 9006096]
• Protein Sequence: MAAEDVVATGADPSELEGGGLLQEIFTSPLNLLLLGLCIFLLYKIVRGDQPGASGDNDDDEPPPLPRLKPRDFTPAELRRYDGVQDPRILMAINGKVFDVTKGRKFYGPEGPYGVFAGRDASRGLATFCLDKEALKDEYDDLSDLTPAQQETLNDWDSQFTFKYHHVGKLLKEGEEPTVYSDDEEPKDEAARKSD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
54	Phosphorylation	RGDQPGASGDNDDDE HCCCCCCCCCCCCCC	53.23	28689409
74	Phosphorylation	RLKPRDFTPAELRRY CCCCCCCCHHHHHCC	26.36	29779826
102	Acetylation	GKVFDVTKGRKFYGP CEEEEECCCCCCCCC	57.47	22902405
105	Acetylation	FDVTKGRKFYGPEGP EEECCCCCCCCCCCC	52.16	22902405
105	Succinylation	FDVTKGRKFYGPEGP EEECCCCCCCCCCCC	52.16	26843850
113	Phosphorylation	FYGPEGPYGVFAGRD CCCCCCCCCEECCCC	36.46	22276854
146	Phosphorylation	YDDLSDLTPAQQETL CCCHHHCCHHHHHHH	22.90	22276854
163	Acetylation	WDSQFTFKYHHVGKL CCHHHHEEEEHHHHH	40.39	22902405
169	Acetylation	FKYHHVGKLLKEGEE EEEEHHHHHHHCCCC	49.94	22902405
172	Acetylation	HHVGKLLKEGEEPTV EHHHHHHHCCCCCCC	74.28	22902405
178	Phosphorylation	LKEGEEPTVYSDDEE HHCCCCCCCCCCCCC	35.04	23712012
180	Phosphorylation	EGEEPTVYSDDEEPK CCCCCCCCCCCCCCH	14.62	23712012
181	Phosphorylation	GEEPTVYSDDEEPKD CCCCCCCCCCCCCHH	33.96	19700791
187	Succinylation	YSDDEEPKDEAARKS CCCCCCCHHHHHHHC	72.05	26843850
194	Phosphorylation	KDEAARKSD------ HHHHHHHCC------	42.89	19700791

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PGRC1_RAT !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PGRC1_RAT !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PGRC1_RAT !!

Protein-Protein Interaction

Oops, there are no PPI records of PGRC1_RAT !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.

Related Literatures of Post-Translational Modification

Phosphorylation

"Quantitative phosphoproteomics of vasopressin-sensitive renal cells:regulation of aquaporin-2 phosphorylation at two sites.";
Hoffert J.D., Pisitkun T., Wang G., Shen R.-F., Knepper M.A.;
Proc. Natl. Acad. Sci. U.S.A. 103:7159-7164(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-178 AND SER-181, ANDMASS SPECTROMETRY.
PubMed: 16641100