PGPSD_DROME - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PGPSD_DROME
• UniProt AC: Q9VS97
• Protein Name: Peptidoglycan-recognition protein SD
• Gene Name: PGRP-SD
• Organism: Drosophila melanogaster (Fruit fly).
• Sequence Length: 186
• Subcellular Localization: Secreted .
• Protein Description: Peptidoglycan-recognition protein that plays a key role in innate immnunity by binding to peptidoglycans (PGN) of Gram-positive bacteria and activating the Toll pathway. Has no activity against on Gram-negative bacteria and fungi. Shows some partial redundancy with PRPGP-SA in Gram-positive bacteria recognition. May act by activating the proteolytic cleavage of Spatzle and the subsequent activation of Toll pathway. Recognizes S.aureus PGN..
• Protein Sequence: MTWIGLLIVGLTAIAVQGEVPIVTRAEWNAKPPNGAIDSMETPLPRAVIAHTAGGACADDVTCSQHMQNLQNFQMSKQKFSDIGYHYLIGGNGKVYEGRSPSQRGAFAGPNNDGSLGIAFIGNFEERAPNKEALDAAKELLEQAVKQAQLVEGYKLLGHRQVSATKSPGEALYALIQQWPNWSEEM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
181	N-linked_Glycosylation	ALIQQWPNWSEEM-- HHHHHCCCCCCCC--	52.53	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PGPSD_DROME !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PGPSD_DROME !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PGPSD_DROME !!

Protein-Protein Interaction

Oops, there are no PPI records of PGPSD_DROME !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.