UniProt ID | PGML4_ARATH | |
---|---|---|
UniProt AC | Q9SCS3 | |
Protein Name | Phosphoglycerate mutase-like protein 4 {ECO:0000305} | |
Gene Name | At3g50520 {ECO:0000312|Araport:AT3G50520} | |
Organism | Arabidopsis thaliana (Mouse-ear cress). | |
Sequence Length | 230 | |
Subcellular Localization | ||
Protein Description | May play a role in carbohydrates metabolism.. | |
Protein Sequence | MEESRFDSEDVDYAEIVVVRHGETSWNAERKIQGHLDVELNDAGRQQAQRVAERLSKEQKISHVYSSDLKRAFETAQIIAAKCGKLEVLTDRDLRERHLGDMQGLVYQEASKIRPEAYKAFSSNRTDVDIPGGGESLDKLYDRCTTALQRIGDKHKGERIVVVTHGGVIRSLYERARPSARKVEKILNTSVNVFRLFDGDKWTIQVWGDVSHLEETGFLQSGFGGDRTSG | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
75 | Phosphorylation | DLKRAFETAQIIAAK HHHHHHHHHHHHHHH | 30291188 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGML4_ARATH !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGML4_ARATH !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGML4_ARATH !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PGML4_ARATH !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...