| UniProt ID | PGAM1_CHICK | |
|---|---|---|
| UniProt AC | Q5ZLN1 | |
| Protein Name | Phosphoglycerate mutase 1 | |
| Gene Name | PGAM1 {ECO:0000250|UniProtKB:P18669} | |
| Organism | Gallus gallus (Chicken). | |
| Sequence Length | 254 | |
| Subcellular Localization | ||
| Protein Description | Interconversion of 3- and 2-phosphoglycerate with 2,3-bisphosphoglycerate as the primer of the reaction. Can also catalyze the reaction of EC 5.4.2.4 (synthase), but with a reduced activity.. | |
| Protein Sequence | MAAYRLVLVRHGESAWNLENRFCGWYDADLSPAGQQEARRGGEALRDAGYEFDICFTSVQKRAIRTLWNVLDAIDQMWLPVVRTWRLNERHYGALTGLNKAETAAKHGEAQVKIWRRSFDIPPPPMQSDHPFFSTISKDRRYADLTEDQLPTCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGMSEEAIMELNLPTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKVKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PGAM1_CHICK !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PGAM1_CHICK !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PGAM1_CHICK !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PGAM1_CHICK !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...