PFD5_CAEEL - dbPTM
PFD5_CAEEL - PTM Information in dbPTM
Basic Information of Protein
UniProt ID PFD5_CAEEL
UniProt AC Q21993
Protein Name Probable prefoldin subunit 5
Gene Name pfd-5
Organism Caenorhabditis elegans.
Sequence Length 152
Subcellular Localization
Protein Description Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity)..
Protein Sequence MAEEPKGVPLSELSLQQLGELQKNCEQELNFFQESFNALKGLLTRNEKSISALDDVKIATAGHTALIPLSESLYIRAELSDPSKHLVEIGTGYFVELDREKAKAIFDRKKEHITKQVETVEGILKEKRRTRAYISDAFQTKVQSQLATMNTQ
Overview of Protein Modification Sites with Functional and Structural Information
Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations Modification Substrate Peptides
&
Secondary Structure
ASA (%) Reference Orthologous
Protein Cluster

Oops, there are no PTM records of PFD5_CAEEL !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)
Modified Location Modified Residue Modification Type of Upstream Proteins Gene Name of Upstream Proteins UniProt AC of Upstream Proteins Sources

Oops, there are no upstream regulatory protein records of PFD5_CAEEL !!

Functions of PTM Sites
Modified Location Modified Residue Modification Function Reference

Oops, there are no descriptions of PTM sites of PFD5_CAEEL !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location Modification Variant Position
(Distance <= 10)
Residue Change SAP Related Disease Reference

Oops, there are no SNP-PTM records of PFD5_CAEEL !!

Protein-Protein Interaction
Interacting Protein Gene Name Interaction Type PPI Reference Domain-Domain Interactions

Oops, there are no PPI records of PFD5_CAEEL !!

Drug and Disease Associations
Kegg Drug
DrugBank
There are no disease associations of PTM sites.
Regulatory Network of PFD5_CAEEL

loading...

Related Literatures of Post-Translational Modification

TOP