PFD3_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PFD3_ARATH
• UniProt AC: P57741
• Protein Name: Probable prefoldin subunit 3
• Gene Name: At5g49510
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 195
• Protein Description: Binds specifically to cytosolic chaperonin (c-CPN) and transfers target proteins to it. Binds to nascent polypeptide chain and promotes folding in an environment in which there are many competing pathways for nonnative proteins (By similarity)..
• Protein Sequence: MSSSSPSGSGSDLTERRGIPAAKFIQDVETYLSQSGLDPNSALAFHQERLQQYKVVEMKLLAQQRDLQAKIPDIEKCLEVVATLEAKKGTGEALLADFEVSEGIYSRACIEDTDSVCLWLGANVMLEYSCEEASALLKNNLENAKASLEVLVADLQFLRDQVTVTQVTIARVYNWDVHQRRVKQVTPTAIAVADS

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSSSSPSGS ------CCCCCCCCC	38.64	22223895
2	Phosphorylation	------MSSSSPSGS ------CCCCCCCCC	38.64	19880383
5	Phosphorylation	---MSSSSPSGSGSD ---CCCCCCCCCCCC	25.65	25561503
7	Phosphorylation	-MSSSSPSGSGSDLT -CCCCCCCCCCCCHH	47.76	25561503

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PFD3_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PFD3_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PFD3_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of PFD3_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.