dbPTM

PEX7_SCHPO - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PEX7_SCHPO
UniProt AC	P78798
Protein Name	Peroxisomal targeting signal 2 receptor
Gene Name	pex7
Organism	Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast).
Sequence Length	308
Subcellular Localization	Peroxisome. Cytoplasm .
Protein Description	Binds to the N-terminal PTS2-type peroxisomal targeting signal and plays an essential role in peroxisomal protein import..
Protein Sequence	MLSLRTPGFQGESVQFSPLVENKIAVAAVTHYGLGGSGRLYIHDVTPKGIQVCQHYDVEDSLFGVRWSQNCENQVYACCGDGSLRLFDLTMPSKPIHKWKEHKAEIVAIDTNTVDRRIVVTGSWDGTIKLWLGNLPNSVQTLNNGSNSRILTVATHYSSPNLLGYTSSDGLCKFWDFRSSDKFMSIEIPNQITCMNWSKSNHRMVYTADNNNLVYCYDIANLKTPLSVLSGHQLAVRSIKSSNSAHDLLATASYDMTSRIFDPEQHSCIRKVDLHSEFVRDVDWSDFGDGSWIASVGWDESLYIWNAF

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of PEX7_SCHPO !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PEX7_SCHPO !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PEX7_SCHPO !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PEX7_SCHPO !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
YHH5_SCHPO	SPBC28F2.05c	physical	26771498

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PEX7_SCHPO

Related Literatures of Post-Translational Modification