UniProt ID | PEX19_MOUSE | |
---|---|---|
UniProt AC | Q8VCI5 | |
Protein Name | Peroxisomal biogenesis factor 19 | |
Gene Name | Pex19 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 299 | |
Subcellular Localization |
Cytoplasm . Peroxisome membrane Lipid-anchor Cytoplasmic side . Mainly cytoplasmic, some fraction membrane-associated to the outer surface of peroxisomes. |
|
Protein Description | Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53.. | |
Protein Sequence | MAAAEEGCGVGVEDDRELEELLESALDDFDKAKPSPEHAPTISAPDASGPQKRAPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLSGLAKNATELQNSGMSEEELMKAMEGLGMDEGDGEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Acetylation | ------MAAAEEGCG ------CCCCCCCCC | 18.51 | - | |
35 | Phosphorylation | DFDKAKPSPEHAPTI HHHHCCCCCCCCCCC | 42.06 | 25521595 | |
41 | Phosphorylation | PSPEHAPTISAPDAS CCCCCCCCCCCCCCC | 28.48 | 26239621 | |
43 | Phosphorylation | PEHAPTISAPDASGP CCCCCCCCCCCCCCC | 35.91 | 25159016 | |
48 | Phosphorylation | TISAPDASGPQKRAP CCCCCCCCCCCCCCC | 59.39 | 25159016 | |
52 | Ubiquitination | PDASGPQKRAPGDTA CCCCCCCCCCCCCHH | 54.37 | 22790023 | |
60 | Ubiquitination | RAPGDTAKDALFASQ CCCCCHHHHHHHHCH | 45.70 | 22790023 | |
66 | Phosphorylation | AKDALFASQEKFFQE HHHHHHHCHHHHHHH | 31.38 | 27742792 | |
92 | Ubiquitination | AEFEKAMKELAEEEP HHHHHHHHHHHHHCH | 55.20 | 22790023 | |
107 | Ubiquitination | HLVEQFQKLSEAAGR HHHHHHHHHHHHHCC | 56.09 | 22790023 | |
117 | Phosphorylation | EAAGRVGSDASSQQE HHHCCCCCCHHHHHH | 27.44 | 22817900 | |
121 | Phosphorylation | RVGSDASSQQEFTSC CCCCCHHHHHHHHHH | 37.29 | 29514104 | |
130 | Ubiquitination | QEFTSCLKETLSGLA HHHHHHHHHHHHHHH | 53.64 | 22790023 | |
134 | Phosphorylation | SCLKETLSGLAKNAT HHHHHHHHHHHHCHH | 38.90 | 20469934 | |
138 | Ubiquitination | ETLSGLAKNATELQN HHHHHHHHCHHHHHH | 52.75 | 22790023 | |
141 | Phosphorylation | SGLAKNATELQNSGM HHHHHCHHHHHHCCC | 46.77 | 28066266 | |
146 | Phosphorylation | NATELQNSGMSEEEL CHHHHHHCCCCHHHH | 23.94 | 26643407 | |
149 | Phosphorylation | ELQNSGMSEEELMKA HHHHCCCCHHHHHHH | 45.44 | 28066266 | |
198 | Ubiquitination | SLKEITEKYPEWLQS HHHHHHHHCHHHHHH | 58.41 | 22790023 | |
205 | Phosphorylation | KYPEWLQSHQDSTPP HCHHHHHHCCCCCCH | 22.42 | 29514104 | |
229 | S-nitrosylation | HSVMVKICEQFEAET HHHHHHHHHHHHCCC | 2.52 | 21278135 | |
229 | S-nitrosocysteine | HSVMVKICEQFEAET HHHHHHHHHHHHCCC | 2.52 | - | |
236 | Phosphorylation | CEQFEAETPTDSEAT HHHHHCCCCCCCHHH | 38.24 | 25521595 | |
238 | Phosphorylation | QFEAETPTDSEATQR HHHCCCCCCCHHHHH | 60.62 | 19060867 | |
240 | Phosphorylation | EAETPTDSEATQRAR HCCCCCCCHHHHHHH | 31.44 | 19060867 | |
243 | Phosphorylation | TPTDSEATQRARFEA CCCCCHHHHHHHHHH | 17.97 | 28066266 | |
296 | Farnesylation | PGANGEQCLIM---- CCCCCCCCCCC---- | 2.12 | - | |
296 | Methylation | PGANGEQCLIM---- CCCCCCCCCCC---- | 2.12 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEX19_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEX19_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEX19_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PEX19_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...