PEX19_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PEX19_MOUSE
• UniProt AC: Q8VCI5
• Protein Name: Peroxisomal biogenesis factor 19
• Gene Name: Pex19
• Organism: Mus musculus (Mouse).
• Sequence Length: 299
• Subcellular Localization: Cytoplasm . Peroxisome membrane ; Lipid-anchor ; Cytoplasmic side . Mainly cytoplasmic, some fraction membrane-associated to the outer surface of peroxisomes.
• Protein Description: Necessary for early peroxisomal biogenesis. Acts both as a cytosolic chaperone and as an import receptor for peroxisomal membrane proteins (PMPs). Binds and stabilizes newly synthesized PMPs in the cytoplasm by interacting with their hydrophobic membrane-spanning domains, and targets them to the peroxisome membrane by binding to the integral membrane protein PEX3. Excludes CDKN2A from the nucleus and prevents its interaction with MDM2, which results in active degradation of TP53..
• Protein Sequence: MAAAEEGCGVGVEDDRELEELLESALDDFDKAKPSPEHAPTISAPDASGPQKRAPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDASSQQEFTSCLKETLSGLAKNATELQNSGMSEEELMKAMEGLGMDEGDGEASILPIMQSIMQNLLSKDVLYPSLKEITEKYPEWLQSHQDSTPPEQFEKYQQQHSVMVKICEQFEAETPTDSEATQRARFEAMLDLMQQLQALGHPPKELAGEMPPGLNFDLDALNLSGPPGANGEQCLIM

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MAAAEEGCG ------CCCCCCCCC	18.51	-
35	Phosphorylation	DFDKAKPSPEHAPTI HHHHCCCCCCCCCCC	42.06	25521595
41	Phosphorylation	PSPEHAPTISAPDAS CCCCCCCCCCCCCCC	28.48	26239621
43	Phosphorylation	PEHAPTISAPDASGP CCCCCCCCCCCCCCC	35.91	25159016
48	Phosphorylation	TISAPDASGPQKRAP CCCCCCCCCCCCCCC	59.39	25159016
52	Ubiquitination	PDASGPQKRAPGDTA CCCCCCCCCCCCCHH	54.37	22790023
60	Ubiquitination	RAPGDTAKDALFASQ CCCCCHHHHHHHHCH	45.70	22790023
66	Phosphorylation	AKDALFASQEKFFQE HHHHHHHCHHHHHHH	31.38	27742792
92	Ubiquitination	AEFEKAMKELAEEEP HHHHHHHHHHHHHCH	55.20	22790023
107	Ubiquitination	HLVEQFQKLSEAAGR HHHHHHHHHHHHHCC	56.09	22790023
117	Phosphorylation	EAAGRVGSDASSQQE HHHCCCCCCHHHHHH	27.44	22817900
121	Phosphorylation	RVGSDASSQQEFTSC CCCCCHHHHHHHHHH	37.29	29514104
130	Ubiquitination	QEFTSCLKETLSGLA HHHHHHHHHHHHHHH	53.64	22790023
134	Phosphorylation	SCLKETLSGLAKNAT HHHHHHHHHHHHCHH	38.90	20469934
138	Ubiquitination	ETLSGLAKNATELQN HHHHHHHHCHHHHHH	52.75	22790023
141	Phosphorylation	SGLAKNATELQNSGM HHHHHCHHHHHHCCC	46.77	28066266
146	Phosphorylation	NATELQNSGMSEEEL CHHHHHHCCCCHHHH	23.94	26643407
149	Phosphorylation	ELQNSGMSEEELMKA HHHHCCCCHHHHHHH	45.44	28066266
198	Ubiquitination	SLKEITEKYPEWLQS HHHHHHHHCHHHHHH	58.41	22790023
205	Phosphorylation	KYPEWLQSHQDSTPP HCHHHHHHCCCCCCH	22.42	29514104
229	S-nitrosylation	HSVMVKICEQFEAET HHHHHHHHHHHHCCC	2.52	21278135
229	S-nitrosocysteine	HSVMVKICEQFEAET HHHHHHHHHHHHCCC	2.52	-
236	Phosphorylation	CEQFEAETPTDSEAT HHHHHCCCCCCCHHH	38.24	25521595
238	Phosphorylation	QFEAETPTDSEATQR HHHCCCCCCCHHHHH	60.62	19060867
240	Phosphorylation	EAETPTDSEATQRAR HCCCCCCCHHHHHHH	31.44	19060867
243	Phosphorylation	TPTDSEATQRARFEA CCCCCHHHHHHHHHH	17.97	28066266
296	Farnesylation	PGANGEQCLIM---- CCCCCCCCCCC----	2.12	-
296	Methylation	PGANGEQCLIM---- CCCCCCCCCCC----	2.12	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PEX19_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PEX19_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PEX19_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of PEX19_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.