| UniProt ID | PERP_HUMAN | |
|---|---|---|
| UniProt AC | Q96FX8 | |
| Protein Name | p53 apoptosis effector related to PMP-22 | |
| Gene Name | PERP | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 193 | |
| Subcellular Localization |
Cell junction, desmosome . Cell membrane Multi-pass membrane protein . Associated with desmosomes. |
|
| Protein Description | Component of intercellular desmosome junctions. Plays a role in stratified epithelial integrity and cell-cell adhesion by promoting desmosome assembly. Plays a role as an effector in the TP53-dependent apoptotic pathway (By similarity).. | |
| Protein Sequence | MIRCGLACERCRWILPLLLLSAIAFDIIALAGRGWLQSSDHGQTSSLWWKCSQEGGGSGSYEEGCQSLMEYAWGRAAAAMLFCGFIILVICFILSFFALCGPQMLVFLRVIGGLLALAAVFQIISLVIYPVKYTQTFTLHANPAVTYIYNWAYGFGWAATIILIGCAFFFCCLPNYEDDLLGNAKPRYFYTSA | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 4 | S-palmitoylation | ----MIRCGLACERC ----CCCCCHHHHHH | 3.47 | 29575903 | |
| 8 | S-palmitoylation | MIRCGLACERCRWIL CCCCCHHHHHHCHHH | 3.99 | 29575903 | |
| 38 | Phosphorylation | AGRGWLQSSDHGQTS HCCCHHCCCCCCCCE | 35.25 | 20068231 | |
| 39 | Phosphorylation | GRGWLQSSDHGQTSS CCCHHCCCCCCCCEE | 22.21 | 20068231 | |
| 44 | Phosphorylation | QSSDHGQTSSLWWKC CCCCCCCCEEEEEEE | 25.52 | 20068231 | |
| 45 | Phosphorylation | SSDHGQTSSLWWKCS CCCCCCCEEEEEEEC | 18.62 | 20068231 | |
| 46 | Phosphorylation | SDHGQTSSLWWKCSQ CCCCCCEEEEEEECC | 31.25 | 20068231 | |
| 190 | Phosphorylation | NAKPRYFYTSA---- CCCCCEEECCC---- | 7.28 | 22461510 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PERP_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PERP_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PERP_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PERP_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
