| UniProt ID | PER3_ARATH | |
|---|---|---|
| UniProt AC | O23044 | |
| Protein Name | Peroxidase 3 | |
| Gene Name | PER3 | |
| Organism | Arabidopsis thaliana (Mouse-ear cress). | |
| Sequence Length | 326 | |
| Subcellular Localization | Secreted . | |
| Protein Description | Removal of H(2)O(2), oxidation of toxic reductants, biosynthesis and degradation of lignin, suberization, auxin catabolism, response to environmental stresses such as wounding, pathogen attack and oxidative stress. These functions might be dependent on each isozyme/isoform in each plant tissue.. | |
| Protein Sequence | MNCLIAIALSVSFFLVGIVGPIQAQLQMNFYANSCPNAEKIVQDFVSNHVSNAPSLAAALIRMHFHDCFVRGCDGSVLINSTSGNAERDATPNLTVRGFGFIDAIKSVLEAQCPGIVSCADIIALASRDAVVFTGGPNWSVPTGRRDGRISNAAEALANIPPPTSNITNLQTLFANQGLDLKDLVLLSGAHTIGVSHCSSFTNRLYNFTGRGGQDPALDSEYAANLKSRKCPSLNDNKTIVEMDPGSRKTFDLSYYQLVLKRRGLFQSDSALTTNPTTLSNINRILTGSVGSFFSEFAKSMEKMGRINVKTGSAGVVRRQCSVANS | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 80 | N-linked_Glycosylation | CDGSVLINSTSGNAE CCCCEEEECCCCCCC | 34.77 | - | |
| 138 | N-linked_Glycosylation | VVFTGGPNWSVPTGR EEECCCCCCCCCCCC | 47.10 | - | |
| 166 | N-linked_Glycosylation | NIPPPTSNITNLQTL CCCCCCCCCCHHHHH | 47.81 | - | |
| 207 | N-linked_Glycosylation | SFTNRLYNFTGRGGQ HHHHCCCCCCCCCCC | 32.37 | - | |
| 237 | N-linked_Glycosylation | KCPSLNDNKTIVEMD CCCCCCCCCEEEEEC | 42.15 | - | |
| 239 | Phosphorylation | PSLNDNKTIVEMDPG CCCCCCCEEEEECCC | 36.19 | 22074104 | |
| 256 | Phosphorylation | KTFDLSYYQLVLKRR CEEECHHHHHHHHHC | 7.62 | 22074104 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PER3_ARATH !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PER3_ARATH !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PER3_ARATH !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PER3_ARATH !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
