| UniProt ID | PEBP4_HUMAN | |
|---|---|---|
| UniProt AC | Q96S96 | |
| Protein Name | Phosphatidylethanolamine-binding protein 4 | |
| Gene Name | PEBP4 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 227 | |
| Subcellular Localization | Lysosome . | |
| Protein Description | Seems to promote cellular resistance to TNF-induced apoptosis by inhibiting activation of the Raf-1/MEK/ERK pathway, JNK and phosphatidylethanolamine externalization.. | |
| Protein Sequence | MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQKITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPSPPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPRERASEPKHKNQAEIAAC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 70 | Acetylation | DCNNYRQKITSWMEP CCCCHHHHHHHHHHC | 38.66 | 25038526 | |
| 72 | Phosphorylation | NNYRQKITSWMEPIV CCHHHHHHHHHHCHH | 24.30 | 23898821 | |
| 73 | Phosphorylation | NYRQKITSWMEPIVK CHHHHHHHHHHCHHC | 28.09 | 23898821 | |
| 163 | Phosphorylation | LQEGKVISLLPKENK EECCCEEEEEECCCC | 27.17 | 23403867 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PEBP4_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEBP4_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEBP4_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| MP2K1_HUMAN | MAP2K1 | physical | 15302887 | |
| RAF1_HUMAN | RAF1 | physical | 15302887 | |
| RAF1_HUMAN | RAF1 | physical | 19197339 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...