| UniProt ID | PEBP1_RAT | |
|---|---|---|
| UniProt AC | P31044 | |
| Protein Name | Phosphatidylethanolamine-binding protein 1 | |
| Gene Name | Pebp1 | |
| Organism | Rattus norvegicus (Rat). | |
| Sequence Length | 187 | |
| Subcellular Localization |
Cytoplasm. Membrane Peripheral membrane protein. |
|
| Protein Description | Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation (By similarity).; HCNP may be involved in the function of the presynaptic cholinergic neurons of the central nervous system. HCNP increases the production of choline acetyltransferase but not acetylcholinesterase. Seems to be mediated by a specific receptor.. | |
| Protein Sequence | MAADISQWAGPLSLQEVDEPPQHALRVDYGGVTVDELGKVLTPTQVMNRPSSISWDGLDPGKLYTLVLTDPDAPSRKDPKFREWHHFLVVNMKGNDISSGTVLSEYVGSGPPKDTGLHRYVWLVYEQEQPLNCDEPILSNKSGDNRGKFKVESFRKKYHLGAPVAGTCFQAEWDDSVPKLHDQLAGK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAADISQWA ------CCCCHHHHC | 17.53 | 1611510 | |
| 6 | Phosphorylation | --MAADISQWAGPLS --CCCCHHHHCCCCC | 21.88 | 23984901 | |
| 13 | Phosphorylation | SQWAGPLSLQEVDEP HHHCCCCCCCCCCCC | 31.01 | 27097102 | |
| 42 | Phosphorylation | DELGKVLTPTQVMNR HHHCCCCCCHHHCCC | 27.55 | 27097102 | |
| 44 | Phosphorylation | LGKVLTPTQVMNRPS HCCCCCCHHHCCCCC | 28.67 | 29779826 | |
| 51 | Phosphorylation | TQVMNRPSSISWDGL HHHCCCCCCCCCCCC | 36.75 | 23991683 | |
| 52 | Phosphorylation | QVMNRPSSISWDGLD HHCCCCCCCCCCCCC | 24.27 | 23991683 | |
| 54 | Phosphorylation | MNRPSSISWDGLDPG CCCCCCCCCCCCCCC | 22.51 | 27097102 | |
| 77 | Acetylation | DPDAPSRKDPKFREW CCCCCCCCCCCCCCC | 80.75 | 22902405 | |
| 80 | Acetylation | APSRKDPKFREWHHF CCCCCCCCCCCCEEE | 68.16 | 22902405 | |
| 98 | Phosphorylation | NMKGNDISSGTVLSE ECCCCCCCCCEEHHH | 26.11 | 25575281 | |
| 99 | Phosphorylation | MKGNDISSGTVLSEY CCCCCCCCCEEHHHC | 38.53 | 25575281 | |
| 101 | Phosphorylation | GNDISSGTVLSEYVG CCCCCCCEEHHHCCC | 21.88 | 25575281 | |
| 104 | Phosphorylation | ISSGTVLSEYVGSGP CCCCEEHHHCCCCCC | 23.65 | 25575281 | |
| 106 | Phosphorylation | SGTVLSEYVGSGPPK CCEEHHHCCCCCCCC | 13.51 | 25575281 | |
| 113 | Acetylation | YVGSGPPKDTGLHRY CCCCCCCCCCCCCEE | 71.68 | 22902405 | |
| 148 | Acetylation | KSGDNRGKFKVESFR CCCCCCCCEEEEHHH | 38.48 | 22902405 | |
| 150 | Acetylation | GDNRGKFKVESFRKK CCCCCCEEEEHHHHH | 48.88 | 22902405 | |
| 153 | Phosphorylation | RGKFKVESFRKKYHL CCCEEEEHHHHHCCC | 33.08 | 29779826 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
| 153 | S | Phosphorylation | Kinase | PRKCA | P05696 | GPS |
| 153 | S | Phosphorylation | Kinase | PKCB | P68403 | PSP |
| 153 | S | Phosphorylation | Kinase | PRKCB | P68403-2 | GPS |
| 153 | S | Phosphorylation | Kinase | PRKCG | P63318 | GPS |
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PEBP1_RAT !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PEBP1_RAT !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
| M3K7_MOUSE | Map3k7 | physical | 11585904 | |
| IKKB_HUMAN | IKBKB | physical | 11585904 | |
| IKKA_HUMAN | CHUK | physical | 11585904 | |
| M3K7_HUMAN | MAP3K7 | physical | 11585904 |
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...