UniProt ID | PDXK_MOUSE | |
---|---|---|
UniProt AC | Q8K183 | |
Protein Name | Pyridoxal kinase | |
Gene Name | Pdxk | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 312 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | Required for synthesis of pyridoxal-5-phosphate from vitamin B6.. | |
Protein Sequence | MEGECRVLSIQSHVVRGYVGNRAAMFPLQVLGFEVDAVNSVQFSNHTGYAHWKGQVLKSQELHELYEGLKVNDVNKYDYVLTGYTRDKSFLAMVVDIVRELKQQNSRLVYVCDPVMGDKWNGEGSMYVPQDLLPVYRDKVVPVADIITPNQFEAELLSGRKIHSQEEAFEVMDMLHCMGPDTVVITSSDLPSSQGSDYLIALGSQRMRKPDGSTVTQRIRMEMRKVEAVFVGTGDLFAAMLLAWTHKHPDNLKVACEKTVSAMQHVLQRTIRCAKAEAGEGQKPSPAQLELRMVQSKRDIEDPEIVVQATVL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
1 | Acetylation | -------MEGECRVL -------CCCCEEEE | 15.66 | - | |
58 | Malonylation | HWKGQVLKSQELHEL CHHCEEECHHHHHHH | 51.76 | 26320211 | |
59 | Phosphorylation | WKGQVLKSQELHELY HHCEEECHHHHHHHH | 25.40 | 25521595 | |
76 | Ubiquitination | LKVNDVNKYDYVLTG CCCCCCCCCCEEEEE | 39.07 | 22790023 | |
89 | Phosphorylation | TGYTRDKSFLAMVVD EEECCCHHHHHHHHH | 29.76 | 29899451 | |
139 | Ubiquitination | LLPVYRDKVVPVADI HHHHCCCCEEEHHHC | 35.81 | 22790023 | |
164 | Phosphorylation | LSGRKIHSQEEAFEV HHCCCCCCHHHHHHH | 42.64 | - | |
209 | Ubiquitination | LGSQRMRKPDGSTVT ECCCCCCCCCCCCHH | 37.81 | 27667366 | |
213 | Phosphorylation | RMRKPDGSTVTQRIR CCCCCCCCCHHHHHH | 27.38 | - | |
258 | Ubiquitination | NLKVACEKTVSAMQH CHHHHHHHHHHHHHH | 54.86 | 22790023 | |
258 | Acetylation | NLKVACEKTVSAMQH CHHHHHHHHHHHHHH | 54.86 | 22826441 | |
283 | Ubiquitination | AEAGEGQKPSPAQLE HHCCCCCCCCHHHHH | 59.32 | 22790023 | |
285 | Phosphorylation | AGEGQKPSPAQLELR CCCCCCCCHHHHHHE | 39.64 | 21454597 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDXK_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDXK_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDXK_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PDXK_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...