| UniProt ID | PDI1_SCHPO | |
|---|---|---|
| UniProt AC | Q10057 | |
| Protein Name | Putative protein disulfide-isomerase C1F5.02 | |
| Gene Name | SPAC1F5.02 | |
| Organism | Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast). | |
| Sequence Length | 492 | |
| Subcellular Localization | Endoplasmic reticulum lumen . | |
| Protein Description | Participates in the folding of proteins containing disulfide bonds, may be involved in glycosylation, prolyl hydroxylation and triglyceride transfer.. | |
| Protein Sequence | MKISNLLAAFLAFSGGFFCASAEVPKVNKEGLNELITADKVLMVKFYAPWCGHCKALAPEYESAADELEKDGISLVEVDCTEEGDLCSEYSIRGYPTLNVFKNGKQISQYSGPRKHDALVKYMRKQLLPTVKPISKDTLENFVEKADDLAVVAFFKDQKLNDTYTEVAEVMKDDFVFAASDDKELAKSLGSNFPGIVAFTKDAAQDSDKLVYTGDWDPASIADFIGVSSIPLLDELNQMTFGKYQQSGLPLGIIFYNSTESRDELYDVFQPLAKKYQDTLRFAFLDAVRYGAVAKQMNVESDWPAFVIANLKSMLKYPFPTTELTAKAMTKFVGDFVDGKLQPKIKSQPIPESQEDLVVLVADNFDDIVMDETKDVLVEFYAPWCGHCKNLAPTYEKLAEEYSDDSNVVVAKIDATENDISVSISGFPTIMFFKANDKVNPVRYEGDRTLEDLSAFIDKHASFEPIKKEKESVPAPDLEDQVAVEDEMADEL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 161 | N-linked_Glycosylation | FFKDQKLNDTYTEVA EECCCCCCCCCHHHH | 46.76 | - | |
| 188 | Phosphorylation | DDKELAKSLGSNFPG CHHHHHHHHCCCCCC | 32.15 | 25720772 | |
| 191 | Phosphorylation | ELAKSLGSNFPGIVA HHHHHHCCCCCCEEE | 40.36 | 25720772 | |
| 257 | N-linked_Glycosylation | PLGIIFYNSTESRDE CEEEEEECCCCCHHH | 31.54 | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDI1_SCHPO !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDI1_SCHPO !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDI1_SCHPO !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PDI1_SCHPO !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...