UniProt ID | PDE6D_MOUSE | |
---|---|---|
UniProt AC | O55057 | |
Protein Name | Retinal rod rhodopsin-sensitive cGMP 3',5'-cyclic phosphodiesterase subunit delta | |
Gene Name | Pde6d | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 150 | |
Subcellular Localization |
Cytoplasm, cytosol . Cytoplasmic vesicle membrane Peripheral membrane protein . Cytoplasm, cytoskeleton, cilium basal body . |
|
Protein Description | Promotes the release of prenylated target proteins from cellular membranes. [PubMed: 22179043 Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location] | |
Protein Sequence | MSAKDERARDILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQMEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLVSTSKVRLFYV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PDE6D_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PDE6D_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PDE6D_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PDE6D_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...