UniProt ID | PD1L2_MOUSE | |
---|---|---|
UniProt AC | Q9WUL5 | |
Protein Name | Programmed cell death 1 ligand 2 | |
Gene Name | Pdcd1lg2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 247 | |
Subcellular Localization |
Cell membrane Single-pass type I membrane protein . |
|
Protein Description | Involved in the costimulatory signal essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production.. | |
Protein Sequence | MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
64 | N-linked_Glycosylation | ASLQKVENDTSLQSE HHHHHHHCCCCHHHH | 61.93 | - | |
157 | N-linked_Glycosylation | LAEVSWQNVSVPANT EEEEEEEEEECCCCC | 23.05 | - | |
163 | N-linked_Glycosylation | QNVSVPANTSHIRTP EEEECCCCCCCCCCC | 35.72 | - | |
189 | N-linked_Glycosylation | LKPQPSRNFSCMFWN ECCCCCCCCEEEEEE | 37.20 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PD1L2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PD1L2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PD1L2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PD1L2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...