PD1L2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: PD1L2_MOUSE
• UniProt AC: Q9WUL5
• Protein Name: Programmed cell death 1 ligand 2
• Gene Name: Pdcd1lg2
• Organism: Mus musculus (Mouse).
• Sequence Length: 247
• Subcellular Localization: Cell membrane ; Single-pass type I membrane protein .
• Protein Description: Involved in the costimulatory signal essential for T-cell proliferation and IFNG production in a PDCD1-independent manner. Interaction with PDCD1 inhibits T-cell proliferation by blocking cell cycle progression and cytokine production..
• Protein Sequence: MLLLLPILNLSLQLHPVAALFTVTAPKEVYTVDVGSSVSLECDFDRRECTELEGIRASLQKVENDTSLQSERATLLEEQLPLGKALFHIPSVQVRDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTGEVQLTCQARGYPLAEVSWQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPSRNFSCMFWNAHMKELTSAIIDPLSRMEPKVPRTWPLHVFIPACTIALIFLAIVIIQRKRI

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
64	N-linked_Glycosylation	ASLQKVENDTSLQSE HHHHHHHCCCCHHHH	61.93	-
157	N-linked_Glycosylation	LAEVSWQNVSVPANT EEEEEEEEEECCCCC	23.05	-
163	N-linked_Glycosylation	QNVSVPANTSHIRTP EEEECCCCCCCCCCC	35.72	-
189	N-linked_Glycosylation	LKPQPSRNFSCMFWN ECCCCCCCCEEEEEE	37.20	-

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of PD1L2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of PD1L2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of PD1L2_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of PD1L2_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.