UniProt ID | PCMD2_MOUSE | |
---|---|---|
UniProt AC | Q8BHD8 | |
Protein Name | Protein-L-isoaspartate O-methyltransferase domain-containing protein 2 | |
Gene Name | Pcmtd2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 359 | |
Subcellular Localization | Cytoplasm. | |
Protein Description | ||
Protein Sequence | MGGAVSAGEDNDELIDNLKEAQYIRTDLVEQAFRAIDRADYYLEEFKENAYKDLAWKHGNIHLSAPCIYSEVMEALDLQPGLSFLNLGSGTGYLSSMVGLILGPFGVNHGVELHSDVTEYAKQKLDVFIRTSDSFDKFDFCEPSFVTGNCLEIAPDCCQYDRVYCGAGVQKEHEEYMKNLLKVGGILVMPLEEKLTKITRTGPSAWETKKILAVSFAPLVQPCRSESGQSRLVQLPPPAVRSLQDLARLAIRGSIKRAMRQEATRGGGLKNTPMFKRRRVRRRRMETIVFLDKEVFASRISNPSDDTSCEDAEEDRREVAERTLQETKPEPPVNFLRQRVLRLPLPDPLKYYLLYYREK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
2 | Myristoylation | ------MGGAVSAGE ------CCCCCCCCC | 32.54 | - | |
6 | Phosphorylation | --MGGAVSAGEDNDE --CCCCCCCCCCCHH | 29.98 | 28066266 | |
124 | Ubiquitination | VTEYAKQKLDVFIRT HHHHHHHHCCEEEEC | 46.04 | - | |
272 | Phosphorylation | RGGGLKNTPMFKRRR CCCCCCCCHHHHHHH | 17.97 | 26824392 | |
287 | Phosphorylation | VRRRRMETIVFLDKE HHHHHHEEEEEECHH | 17.07 | 29514104 | |
301 | Phosphorylation | EVFASRISNPSDDTS HHHHHHCCCCCCCCC | 41.39 | 23684622 | |
304 | Phosphorylation | ASRISNPSDDTSCED HHHCCCCCCCCCCCC | 52.98 | 23684622 | |
307 | Phosphorylation | ISNPSDDTSCEDAEE CCCCCCCCCCCCHHH | 40.02 | 23684622 | |
308 | Phosphorylation | SNPSDDTSCEDAEED CCCCCCCCCCCHHHH | 23.62 | 23684622 | |
328 | Ubiquitination | ERTLQETKPEPPVNF HHHHHHCCCCCCCCH | 46.78 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PCMD2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PCMD2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PCMD2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PCMD2_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...