UniProt ID | PAX1_MOUSE | |
---|---|---|
UniProt AC | P09084 | |
Protein Name | Paired box protein Pax-1 | |
Gene Name | Pax1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 446 | |
Subcellular Localization | Nucleus. | |
Protein Description | This protein is a transcriptional activator. It may play a role in the formation of segmented structures of the embryo. May play an important role in the normal development of the vertebral column.. | |
Protein Sequence | MKFTLGLGSRAWRVSWERAAAAAAGPGAGGALGSGSLRVSSRRGPRLARALPLCLSGGGGARALPDCAGPSPRRSGARQLAGPRAMEQTYGEVNQLGGVFVNGRPLPNAIRLRIVELAQLGIRPCDISRQLRVSHGCVSKILARYNETGSILPGAIGGSKPRVTTPNVVKHIRDYKQGDPGIFAWEIRDRLLADGVCDKYNVPSVSSISRILRNKIGSLAQPGPYEASKQPPPQPALPYNHIYQYPYPSPVSPTGTKMGTHPGVPGSAGHVSIPRSWPSAHSVSNILGIRTFMEQTGALAGSEGAAYSPKMEDWAGVNRAAFPTSPAVNGLEKPALEADIKYTQSASSLSAVGGFLPACAYPASNQHGVYSAPAAGYLSPGPPWPPAQAPPLTPHGAGVAVHGGELAAAMTFKHREGTDRKPPSPGGKATDALGSLHGLPIPASTS | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
424 | Phosphorylation | GTDRKPPSPGGKATD CCCCCCCCCCCHHHH | 44.71 | 25777480 | |
430 | Phosphorylation | PSPGGKATDALGSLH CCCCCHHHHCCHHHC | 25.87 | 25777480 | |
435 | Phosphorylation | KATDALGSLHGLPIP HHHHCCHHHCCCCCC | 20.31 | 25777480 | |
444 | Phosphorylation | HGLPIPASTS----- CCCCCCCCCC----- | 24.67 | 25777480 | |
445 | Phosphorylation | GLPIPASTS------ CCCCCCCCC------ | 40.33 | 25777480 | |
446 | Phosphorylation | LPIPASTS------- CCCCCCCC------- | 35.41 | 25777480 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAX1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAX1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAX1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PAX1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...