UniProt ID | PAQR7_HUMAN | |
---|---|---|
UniProt AC | Q86WK9 | |
Protein Name | Membrane progestin receptor alpha {ECO:0000303|PubMed:23763432} | |
Gene Name | PAQR7 {ECO:0000312|HGNC:HGNC:23146} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 346 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein . |
|
Protein Description | Plasma membrane progesterone (P4) receptor coupled to G proteins. [PubMed: 23763432 Seems to act through a G(i) mediated pathway] | |
Protein Sequence | MAMAQKLSHLLPSLRQVIQEPQLSLQPEPVFTVDRAEVPPLFWKPYIYAGYRPLHQTWRFYFRTLFQQHNEAVNVWTHLLAALVLLLRLALFVETVDFWGDPHALPLFIIVLASFTYLSFSALAHLLQAKSEFWHYSFFFLDYVGVAVYQFGSALAHFYYAIEPAWHAQVQAVFLPMAAFLAWLSCIGSCYNKYIQKPGLLGRTCQEVPSVLAYALDISPVVHRIFVSSDPTTDDPALLYHKCQVVFFLLAAAFFSTFMPERWFPGSCHVFGQGHQLFHIFLVLCTLAQLEAVALDYEARRPIYEPLHTHWPHNFSGLFLLTVGSSILTAFLLSQLVQRKLDQKTK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
13 | Phosphorylation | KLSHLLPSLRQVIQE HHHHHHHHHHHHHHC | 24719451 | ||
193 | Ubiquitination | CIGSCYNKYIQKPGL HHHHHHHHHCCCCCC | 22817900 | ||
194 | Phosphorylation | IGSCYNKYIQKPGLL HHHHHHHHCCCCCCC | - | ||
197 | Ubiquitination | CYNKYIQKPGLLGRT HHHHHCCCCCCCCCC | 21906983 | ||
197 | Ubiquitination | CYNKYIQKPGLLGRT HHHHHCCCCCCCCCC | 21890473 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAQR7_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAQR7_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAQR7_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PAQR7_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...