| UniProt ID | PAGE5_HUMAN | |
|---|---|---|
| UniProt AC | Q96GU1 | |
| Protein Name | P antigen family member 5 | |
| Gene Name | PAGE5 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 130 | |
| Subcellular Localization | ||
| Protein Description | ||
| Protein Sequence | MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAPSGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 28 | Phosphorylation | MSEHVTRSQSSERGN HHHHHHHHHHHCCCC | 30576142 | ||
| 30 | Phosphorylation | EHVTRSQSSERGNDQ HHHHHHHHHCCCCCC | 30576142 | ||
| 31 | Phosphorylation | HVTRSQSSERGNDQE HHHHHHHHCCCCCCC | 24114839 | ||
| 39 | Phosphorylation | ERGNDQESSQPVGPV CCCCCCCCCCCCCCE | 30576142 | ||
| 40 | O-linked_Glycosylation | RGNDQESSQPVGPVI CCCCCCCCCCCCCEE | OGP | ||
| 40 | Phosphorylation | RGNDQESSQPVGPVI CCCCCCCCCCCCCEE | 30576142 | ||
| 98 | Ubiquitination | QQELALLKIEDAPGD HHHHHHHECCCCCCC | - | ||
| 113 | Phosphorylation | GPDVREGTLPTFDPT CCCCCCCCCCCCCHH | 23917254 | ||
| 116 | Phosphorylation | VREGTLPTFDPTKVL CCCCCCCCCCHHHHE | 23917254 | ||
| 121 | Ubiquitination | LPTFDPTKVLEAGEG CCCCCHHHHECCCCC | - |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAGE5_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAGE5_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAGE5_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of PAGE5_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...