UniProt ID | PAGE5_HUMAN | |
---|---|---|
UniProt AC | Q96GU1 | |
Protein Name | P antigen family member 5 | |
Gene Name | PAGE5 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 130 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MQAPWAGNRGWAGTREEVRDMSEHVTRSQSSERGNDQESSQPVGPVIVQQPTEEKRQEEEPPTDNQGIAPSGEIKNEGAPAVQGTDVEAFQQELALLKIEDAPGDGPDVREGTLPTFDPTKVLEAGEGQL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
28 | Phosphorylation | MSEHVTRSQSSERGN HHHHHHHHHHHCCCC | 30576142 | ||
30 | Phosphorylation | EHVTRSQSSERGNDQ HHHHHHHHHCCCCCC | 30576142 | ||
31 | Phosphorylation | HVTRSQSSERGNDQE HHHHHHHHCCCCCCC | 24114839 | ||
39 | Phosphorylation | ERGNDQESSQPVGPV CCCCCCCCCCCCCCE | 30576142 | ||
40 | O-linked_Glycosylation | RGNDQESSQPVGPVI CCCCCCCCCCCCCEE | OGP | ||
40 | Phosphorylation | RGNDQESSQPVGPVI CCCCCCCCCCCCCEE | 30576142 | ||
98 | Ubiquitination | QQELALLKIEDAPGD HHHHHHHECCCCCCC | - | ||
113 | Phosphorylation | GPDVREGTLPTFDPT CCCCCCCCCCCCCHH | 23917254 | ||
116 | Phosphorylation | VREGTLPTFDPTKVL CCCCCCCCCCHHHHE | 23917254 | ||
121 | Ubiquitination | LPTFDPTKVLEAGEG CCCCCHHHHECCCCC | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAGE5_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAGE5_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAGE5_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PAGE5_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...