UniProt ID | PAGE2_HUMAN | |
---|---|---|
UniProt AC | Q7Z2X7 | |
Protein Name | P antigen family member 2 | |
Gene Name | PAGE2 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 111 | |
Subcellular Localization | ||
Protein Description | ||
Protein Sequence | MSELLRARSQSSERGNDQESSQPVGSVIVQEPTEEKRQEEEPPTDNQGIAPSGEIENQAVPAFQGPDMEAFQQELALLKIEDEPGDGPDVREGIMPTFDLTKVLEAGDAQP | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
9 | Phosphorylation | SELLRARSQSSERGN HHHHHHHHHCCCCCC | 30266825 | ||
11 | Phosphorylation | LLRARSQSSERGNDQ HHHHHHHCCCCCCCC | 30266825 | ||
12 | Phosphorylation | LRARSQSSERGNDQE HHHHHHCCCCCCCCC | 30266825 | ||
20 | Phosphorylation | ERGNDQESSQPVGSV CCCCCCCCCCCCCEE | 30266825 | ||
21 | Phosphorylation | RGNDQESSQPVGSVI CCCCCCCCCCCCEEE | 30266825 | ||
26 | Phosphorylation | ESSQPVGSVIVQEPT CCCCCCCEEEECCCC | 30266825 | ||
36 | Ubiquitination | VQEPTEEKRQEEEPP ECCCCHHHHCCCCCC | - | ||
102 | Ubiquitination | MPTFDLTKVLEAGDA CCCCCHHHHHHCCCC | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PAGE2_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PAGE2_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PAGE2_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PAGE2_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...