UniProt ID | PADC1_HUMAN | |
---|---|---|
UniProt AC | Q9BSG0 | |
Protein Name | Protease-associated domain-containing protein 1 | |
Gene Name | PRADC1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 188 | |
Subcellular Localization | Secreted . | |
Protein Description | ||
Protein Sequence | MVPGAAGWCCLVLWLPACVAAHGFRIHDYLYFQVLSPGDIRYIFTATPAKDFGGIFHTRYEQIHLVPAEPPEACGELSNGFFIQDQIALVERGGCSFLSKTRVVQEHGGRAVIISDNAVDNDSFYVEMIQDSTQRTADIPALFLLGRDGYMIRRSLEQHGLPWAIISIPVNVTSIPTFELLQPPWTFW | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
50 | Ubiquitination | IFTATPAKDFGGIFH EEEECCCHHCCCEEE | 55.59 | 22817900 | |
50 | Ubiquitination | IFTATPAKDFGGIFH EEEECCCHHCCCEEE | 55.59 | 21890473 | |
100 | Ubiquitination | GGCSFLSKTRVVQEH CCCCCCCCCEEEEEE | 42.36 | 21963094 | |
121 | N-linked_Glycosylation | ISDNAVDNDSFYVEM ECCCCCCCCCEEEEE | 39.98 | - | |
121 | N-linked_Glycosylation | ISDNAVDNDSFYVEM ECCCCCCCCCEEEEE | 39.98 | 15498570 | |
171 | N-linked_Glycosylation | AIISIPVNVTSIPTF EEEEEECCCCCCCCC | 26.45 | 15498570 | |
171 | N-linked_Glycosylation | AIISIPVNVTSIPTF EEEEEECCCCCCCCC | 26.45 | 15498570 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PADC1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PADC1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PADC1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PADC1_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
N-linked Glycosylation | |
Reference | PubMed |
"N-glycosylation is required for efficient secretion of a novel humansecreted glycoprotein, hPAP21."; Zhou Y.-B., Liu F., Zhu Z.-D., Zhu H., Zhang X., Wang Z.-Q.,Liu J.-H., Han Z.-G.; FEBS Lett. 576:401-407(2004). Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY, GLYCOSYLATION AT ASN-171,PROBABLE ABSENCE OF GLYCOSYLATION AT ASN-121, AND MUTAGENESIS OFASN-121 AND ASN-171. |