UniProt ID | PA2GD_HUMAN | |
---|---|---|
UniProt AC | Q9UNK4 | |
Protein Name | Group IID secretory phospholipase A2 | |
Gene Name | PLA2G2D | |
Organism | Homo sapiens (Human). | |
Sequence Length | 145 | |
Subcellular Localization | Secreted . | |
Protein Description | PA2 catalyzes the calcium-dependent hydrolysis of the 2-acyl groups in 3-sn-phosphoglycerides. L-alpha-1-palmitoyl-2-linoleoyl phosphatidylethanolamine is more efficiently hydrolyzed than the other phospholipids examined.. | |
Protein Sequence | MELALLCGLVVMAGVIPIQGGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCSIYKDYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
41 | Phosphorylation | GKMPILSYWPYGCHC CCCCCHHCCCCCCCC | 13.63 | - | |
82 | Phosphorylation | KTQGCSIYKDYYRYN HHCCCEEHHHEEEEE | 4.98 | - | |
85 | Phosphorylation | GCSIYKDYYRYNFSQ CCEEHHHEEEEECCC | 5.91 | - | |
86 | Phosphorylation | CSIYKDYYRYNFSQG CEEHHHEEEEECCCC | 19.43 | - | |
89 | N-linked_Glycosylation | YKDYYRYNFSQGNIH HHHEEEEECCCCCEE | 22.54 | UniProtKB CARBOHYD | |
126 | Phosphorylation | LKRNLDTYQKRLRFY HHCCHHHHHHHHHHH | 16.23 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of PA2GD_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of PA2GD_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of PA2GD_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of PA2GD_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...