dbPTM

PA1B3_MOUSE - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	PA1B3_MOUSE
UniProt AC	Q61205
Protein Name	Platelet-activating factor acetylhydrolase IB subunit gamma
Gene Name	Pafah1b3
Organism	Mus musculus (Mouse).
Sequence Length	232
Subcellular Localization	Cytoplasm.
Protein Description	Inactivates paf by removing the acetyl group at the sn-2 position. This is a catalytic subunit. Plays an important role during the development of brain..
Protein Sequence	MSGEGENPASKPTPVQDVQGDGRWMSLHHRFVADSKDKEPEVVFIGDSLVQLMHQCEIWRELFSPLHALNFGIGGDSTQHVLWRLENGELEHIRPKIVVVWVGTNNHSHTAEQVTGGIKAIVQLVNKLQPQARVVVLGLLPRGQHPNPLREKNRQVNELVRAALAGYPRAHFLDADPGFVHSDGTISHHDMYDYLHLSRLGYTPVCRALHSLLLRLLAQDQGQGIPLPETAS

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
2	Acetylation	------MSGEGENPA ------CCCCCCCCC	45.62	-
2	Phosphorylation	------MSGEGENPA ------CCCCCCCCC	45.62	24759943
48	Phosphorylation	EVVFIGDSLVQLMHQ CEEEECHHHHHHHHH	25.81	-
56	S-palmitoylation	LVQLMHQCEIWRELF HHHHHHHHHHHHHHH	2.20	24357059
64	Phosphorylation	EIWRELFSPLHALNF HHHHHHHCHHHHHCC	38.89	21183079
206	S-palmitoylation	RLGYTPVCRALHSLL HCCCHHHHHHHHHHH	1.91	24357059
230	Phosphorylation	QGIPLPETAS----- CCCCCCCCCC-----	30.20	23140645
232	Phosphorylation	IPLPETAS------- CCCCCCCC-------	48.45	23140645

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of PA1B3_MOUSE !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of PA1B3_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of PA1B3_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of PA1B3_MOUSE !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of PA1B3_MOUSE

Related Literatures of Post-Translational Modification