| UniProt ID | P5CR3_MOUSE | |
|---|---|---|
| UniProt AC | Q9DCC4 | |
| Protein Name | Pyrroline-5-carboxylate reductase 3 {ECO:0000250|UniProtKB:Q53H96} | |
| Gene Name | Pycr3 {ECO:0000250|UniProtKB:Q53H96} | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 274 | |
| Subcellular Localization | Cytoplasm . | |
| Protein Description | Enzyme that catalyzes the last step in proline biosynthesis. Proline is synthesized from either glutamate or ornithine; both are converted to pyrroline-5-carboxylate (P5C), and then to proline via pyrroline-5-carboxylate reductases (PYCRs). PYCRL is exclusively linked to the conversion of ornithine to proline.. | |
| Protein Sequence | MAATMSEPRRVGFVGAGRMAEAIARGLIQAGKVEAKQVLASAPTDNNLCHFRALGCQTTHSNHEVLQNCPLVIFATKPQVLPTVLAEVAPIVTTEHIIVSVAAGISLSTMEGLLPPNTRVLRVSPNLPCVVQEGAMVMARGHHAGNDDAELLQNLLEACGQCIEVPESYVDIHTGLSGSGVAFVCTFSEALAEGAIKMGMPSGLAHRIAAQTLLGTAKMLQQEGKHPAQLRTDVLTPAGTTIHGLHALERGGFRAATMSAVEAATCRAKELSKK | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 2 | Acetylation | ------MAATMSEPR ------CCCCCCCCC | 16.19 | - | |
| 4 | Phosphorylation | ----MAATMSEPRRV ----CCCCCCCCCCC | 16.22 | 25619855 | |
| 6 | Phosphorylation | --MAATMSEPRRVGF --CCCCCCCCCCCCC | 39.84 | 25619855 | |
| 49 | S-nitrosocysteine | APTDNNLCHFRALGC CCCCCCCCCEEECCC | 2.87 | - | |
| 49 | Glutathionylation | APTDNNLCHFRALGC CCCCCCCCCEEECCC | 2.87 | 24333276 | |
| 49 | S-nitrosylation | APTDNNLCHFRALGC CCCCCCCCCEEECCC | 2.87 | 21278135 | |
| 49 | S-palmitoylation | APTDNNLCHFRALGC CCCCCCCCCEEECCC | 2.87 | 28526873 | |
| 109 | Ubiquitination | AAGISLSTMEGLLPP HHCCCHHHHCCCCCC | 25.24 | 27667366 | |
| 129 | S-palmitoylation | RVSPNLPCVVQEGAM EECCCCCEEEECCCE | 5.44 | 28526873 | |
| 218 | Ubiquitination | QTLLGTAKMLQQEGK HHHHHHHHHHHHCCC | 39.73 | 22790023 | |
| 236 | Phosphorylation | QLRTDVLTPAGTTIH HHCCEEECCCCCCHH | 15.79 | - | |
| 266 | Glutathionylation | SAVEAATCRAKELSK HHHHHHHHHHHHHHC | 3.23 | 24333276 | |
| 266 | S-palmitoylation | SAVEAATCRAKELSK HHHHHHHHHHHHHHC | 3.23 | 28526873 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P5CR3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P5CR3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P5CR3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of P5CR3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...