P4HA2_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: P4HA2_MOUSE
• UniProt AC: Q60716
• Protein Name: Prolyl 4-hydroxylase subunit alpha-2
• Gene Name: P4ha2
• Organism: Mus musculus (Mouse).
• Sequence Length: 537
• Subcellular Localization: Endoplasmic reticulum lumen.
• Protein Description: Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins..
• Protein Sequence: MKLQVLVLVLLMSWFGVLSWVQAEFFTSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKIKSWASKMEALTSRSAADPEGYLAHPVNAYKLVKRLNTDWPALGDLVLQDASAGFVANLSVQRQFFPTDEDESGAARALMRLQDTYKLDPDTISRGELPGTKYQAMLSVDDCFGLGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATVTKSLVLDYLSYAVFQLGDLHRAVELTRRLLSLDPSHERAGGNLRYFERLLEEERGKSLSNQTDAGLATQENLYERPTDYLPERDVYESLCRGEGVKLTPRRQKKLFCRYHHGNRVPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGMGGQYEPHFDFSRSDDEDAFKRLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGTTEVD

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
117	N-linked_Glycosylation	ASAGFVANLSVQRQF CCCCEEEEEEEEECC	27.78	-
127	Phosphorylation	VQRQFFPTDEDESGA EEECCCCCCCCCCHH	47.03	26525534
266	N-linked_Glycosylation	ERGKSLSNQTDAGLA HHCCCCCCCCHHHHH	54.81	-
348	Phosphorylation	VRYYDVMSDEEIERI HHHEECCCHHHHHHH	41.54	26525534
482	Succinylation	GAAIWPKKGTAVFWY CCEECCCCCCEEEHH	58.37	-
482	Succinylation	GAAIWPKKGTAVFWY CCEECCCCCCEEEHH	58.37	23806337

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of P4HA2_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of P4HA2_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of P4HA2_MOUSE !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
PDIA1_HUMAN	P4HB	physical	7753822

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.