UniProt ID | P4HA2_MOUSE | |
---|---|---|
UniProt AC | Q60716 | |
Protein Name | Prolyl 4-hydroxylase subunit alpha-2 | |
Gene Name | P4ha2 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 537 | |
Subcellular Localization | Endoplasmic reticulum lumen. | |
Protein Description | Catalyzes the post-translational formation of 4-hydroxyproline in -Xaa-Pro-Gly- sequences in collagens and other proteins.. | |
Protein Sequence | MKLQVLVLVLLMSWFGVLSWVQAEFFTSIGHMTDLIYAEKDLVQSLKEYILVEEAKLAKIKSWASKMEALTSRSAADPEGYLAHPVNAYKLVKRLNTDWPALGDLVLQDASAGFVANLSVQRQFFPTDEDESGAARALMRLQDTYKLDPDTISRGELPGTKYQAMLSVDDCFGLGRSAYNEGDYYHTVLWMEQVLKQLDAGEEATVTKSLVLDYLSYAVFQLGDLHRAVELTRRLLSLDPSHERAGGNLRYFERLLEEERGKSLSNQTDAGLATQENLYERPTDYLPERDVYESLCRGEGVKLTPRRQKKLFCRYHHGNRVPQLLIAPFKEEDEWDSPHIVRYYDVMSDEEIERIKEIAKPKLARATVRDPKTGVLTVASYRVSKSSWLEEDDDPVVARVNRRMQHITGLTVKTAELLQVANYGMGGQYEPHFDFSRSDDEDAFKRLGTGNRVATFLNYMSDVEAGGATVFPDLGAAIWPKKGTAVFWYNLLRSGEGDYRTRHAACPVLVGCKWVSNKWFHERGQEFLRPCGTTEVD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
117 | N-linked_Glycosylation | ASAGFVANLSVQRQF CCCCEEEEEEEEECC | 27.78 | - | |
127 | Phosphorylation | VQRQFFPTDEDESGA EEECCCCCCCCCCHH | 47.03 | 26525534 | |
266 | N-linked_Glycosylation | ERGKSLSNQTDAGLA HHCCCCCCCCHHHHH | 54.81 | - | |
348 | Phosphorylation | VRYYDVMSDEEIERI HHHEECCCHHHHHHH | 41.54 | 26525534 | |
482 | Succinylation | GAAIWPKKGTAVFWY CCEECCCCCCEEEHH | 58.37 | - | |
482 | Succinylation | GAAIWPKKGTAVFWY CCEECCCCCCEEEHH | 58.37 | 23806337 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P4HA2_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P4HA2_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P4HA2_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
PDIA1_HUMAN | P4HB | physical | 7753822 |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...