UniProt ID | P2Y11_HUMAN | |
---|---|---|
UniProt AC | Q96G91 | |
Protein Name | P2Y purinoceptor 11 | |
Gene Name | P2RY11 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 374 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Receptor for ATP and ADP coupled to G-proteins that activate both phosphatidylinositol-calcium and adenylyl cyclase second messenger systems. Not activated by UTP or UDP.. | |
Protein Sequence | MAANVSGAKSCPANFLAAADDKLSGFQGDFLWPILVVEFLVAVASNGLALYRFSIRKQRPWHPAVVFSVQLAVSDLLCALTLPPLAAYLYPPKHWRYGEAACRLERFLFTCNLLGSVIFITCISLNRYLGIVHPFFARSHLRPKHAWAVSAAGWVLAALLAMPTLSFSHLKRPQQGAGNCSVARPEACIKCLGTADHGLAAYRAYSLVLAGLGCGLPLLLTLAAYGALGRAVLRSPGMTVAEKLRVAALVASGVALYASSYVPYHIMRVLNVDARRRWSTRCPSFADIAQATAALELGPYVGYQVMRGLMPLAFCVHPLLYMAAVPSLGCCCRHCPGYRDSWNPEDAKSTGQALPLNATAAPKPSEPQSRELSQ | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
4 | N-linked_Glycosylation | ----MAANVSGAKSC ----CCCCCCCCCCC | 20.96 | UniProtKB CARBOHYD | |
54 | Phosphorylation | GLALYRFSIRKQRPW CEEEEEEECCCCCCC | 16.69 | 29496963 | |
110 | Phosphorylation | RLERFLFTCNLLGSV HHHHHHHHHHHHCCH | 11.57 | - | |
179 | N-linked_Glycosylation | RPQQGAGNCSVARPE CCCCCCCCCCCCCHH | 17.85 | UniProtKB CARBOHYD | |
235 | Phosphorylation | LGRAVLRSPGMTVAE HHHHHHHCCCCCHHH | 22.96 | - | |
338 | Phosphorylation | CCRHCPGYRDSWNPE CCCCCCCCCCCCCHH | 9.08 | 30108239 | |
341 | Phosphorylation | HCPGYRDSWNPEDAK CCCCCCCCCCHHHHH | 21.54 | 30108239 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P2Y11_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P2Y11_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P2Y11_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of P2Y11_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...