P2C79_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: P2C79_ARATH
• UniProt AC: Q9FKX4
• Protein Name: Probable protein phosphatase 2C 79
• Gene Name: At5g66080
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 385
• Protein Sequence: MLSLFFNFLTSCLWPSSSTTSHTYSDSKGKQDGLLWYKDSAHHLFGDFSMAVVQANNLLEDQSQVESGPLTTLSSSGPYGTFVGVYDGHGGPETSRFVNDHLFHHLKRFAAEQDSMSVDVIRKAYEATEEGFLGVVAKQWAVKPHIAAVGSCCLIGVVCDGKLYVANVGDSRAVLGKVIKATGEVNALQLSAEHNVSIESVRQEMHSLHPDDSHIVVLKHNVWRVKGIIQVSRSIGDVYLKKSEFNKEPLYTKYRLREPMKRPILSWEPSITVHDLQPDDQFLIFASDGLWEQLSNQEAVEIVQNHPRNGIARRLVKAALQEAAKKREMRYSDLNKIERGVRRHFHDDITVVVLFLDTNLLSRASSLKTPSVSIRGGGITLPKKL

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
76	Phosphorylation	PLTTLSSSGPYGTFV CCEEECCCCCCEEEE	40.17	-
239	Phosphorylation	SRSIGDVYLKKSEFN ECCCCCEEECCHHCC	19.97	24894044
270	Phosphorylation	PILSWEPSITVHDLQ CCEECCCCEEEEECC	21.26	28011693
272	Phosphorylation	LSWEPSITVHDLQPD EECCCCEEEEECCCC	19.00	28011693

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of P2C79_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of P2C79_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of P2C79_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MBP_HUMAN	MBP	physical	22968126

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.