P2C60_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: P2C60_ARATH
• UniProt AC: Q9SZ53
• Protein Name: Probable protein phosphatase 2C 60
• Gene Name: At4g31860
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 357
• Protein Sequence: MGIYLSTPKTDKFSEDGENHKLRYGLSSMQGWRASMEDAHAAILDLDDNTSFLGVYDGHGGKVVSKFCAKYLHQQVLSDEAYAAGDVGTSLQKAFFRMDEMMQGQRGWRELAVLGDKINKFSGMIEGLIWSPRSGDSANKPDAWAFEEGPHSDFAGPNSGSTACVAVVRDKQLFVANAGDSRCVISRKNQAYNLSRDHKPDLEAEKERILKAGGFIHAGRVNGSLNLSRAIGDMEFKQNKFLPSEKQIVTASPDVNTVELCDDDDFLVLACDGIWDCMTSQQLVDFIHEQLNSETKLSVVCEKVLDRCLAPNTSGGEGCDNMTMILVRFKNPTPSETELKPEASQAEGNHDEPSSSN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
6	Phosphorylation	--MGIYLSTPKTDKF --CCEEECCCCCCCC	26.20	19880383
7	Phosphorylation	-MGIYLSTPKTDKFS -CCEEECCCCCCCCC	26.64	19880383
10	Phosphorylation	IYLSTPKTDKFSEDG EEECCCCCCCCCCCC	45.70	19880383
131	Phosphorylation	MIEGLIWSPRSGDSA CCEECEECCCCCCCC	11.93	23111157

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of P2C60_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of P2C60_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of P2C60_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference
MBP_HUMAN	MBP	physical	22968126

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.