P2A02_ARATH - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: P2A02_ARATH
• UniProt AC: O81866
• Protein Name: Protein PHLOEM PROTEIN 2-LIKE A2
• Gene Name: PP2A2
• Organism: Arabidopsis thaliana (Mouse-ear cress).
• Sequence Length: 194
• Subcellular Localization: Membrane ; Single-pass membrane protein .
• Protein Sequence: MRVKRRKTVSCCTREISQLHGQSLKQINIGVGSLILTKHQGYEFYCKKVTFVFFCFFKISLNSAYLYTLYSDVRTEVAKMERVAWLEVVGKFETEKLTPNSLYEVVFVVKLIDSAKGWDFRVNFKLVLPTGETKERRENVNLLERNKWVEIPAGEFMISPEHLSGKIEFSMLEVKSDQWKSGLIVKGVAIRPKN

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
70	Phosphorylation	SAYLYTLYSDVRTEV CHHHHHHHHHHHHHH	8.60	24894044
71	Phosphorylation	AYLYTLYSDVRTEVA HHHHHHHHHHHHHHH	32.51	24894044

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of P2A02_ARATH !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of P2A02_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of P2A02_ARATH !!

Protein-Protein Interaction

Oops, there are no PPI records of P2A02_ARATH !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.