UniProt ID | P20D1_HUMAN | |
---|---|---|
UniProt AC | Q6GTS8 | |
Protein Name | N-fatty-acyl-amino acid synthase/hydrolase PM20D1 {ECO:0000305|PubMed:27374330} | |
Gene Name | PM20D1 {ECO:0000312|HGNC:HGNC:26518} | |
Organism | Homo sapiens (Human). | |
Sequence Length | 502 | |
Subcellular Localization | Secreted . | |
Protein Description | Bidirectional N-fatty-acyl amino acid synthase/hydrolase that regulates the production of N-fatty-acyl amino acids. These metabolites are endogenous chemical uncouplers of mitochondrial respiration. In an UCP1-independent manner, maybe through interaction with mitochondrial transporters, they promote proton leakage into the mitochondrial matrix. Thereby, this secreted protein may indirectly regulate the bodily dissipation of chemical energy as heat through thermogenic respiration.. | |
Protein Sequence | MAQRCVCVLALVAMLLLVFPTVSRSMGPRSGEHQRASRIPSQFSKEERVAMKEALKGAIQIPTVTFSSEKSNTTALAEFGKYIHKVFPTVVSTSFIQHEVVEEYSHLFTIQGSDPSLQPYLLMAHFDVVPAPEEGWEVPPFSGLERDGIIYGRGTLDDKNSVMALLQALELLLIRKYIPRRSFFISLGHDEESSGTGAQRISALLQSRGVQLAFIVDEGGFILDDFIPNFKKPIALIAVSEKGSMNLMLQVNMTSGHSSAPPKETSIGILAAAVSRLEQTPMPIIFGSGTVVTVLQQLANEFPFPVNIILSNPWLFEPLISRFMERNPLTNAIIRTTTALTIFKAGVKFNVIPPVAQATVNFRIHPGQTVQEVLELTKNIVADNRVQFHVLSAFDPLPVSPSDDKALGYQLLRQTVQSVFPEVNITAPVTSIGNTDSRFFTNLTTGIYRFYPIYIQPEDFKRIHGVNEKISVQAYETQVKFIFELIQNADTDQEPVSHLHKL | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
25 | Phosphorylation | VFPTVSRSMGPRSGE HHHHHHHHCCCCCCC | 22.15 | 28509920 | |
37 | Phosphorylation | SGEHQRASRIPSQFS CCCCCHHHCCCCCCC | 32.69 | 28509920 | |
44 | Phosphorylation | SRIPSQFSKEERVAM HCCCCCCCHHHHHHH | 31.36 | 23403867 | |
63 | Phosphorylation | KGAIQIPTVTFSSEK CCCEECCEEEECCCC | 33.53 | 30301811 | |
65 | Phosphorylation | AIQIPTVTFSSEKSN CEECCEEEECCCCCC | 21.93 | 30301811 | |
67 | Phosphorylation | QIPTVTFSSEKSNTT ECCEEEECCCCCCCH | 28.37 | 30301811 | |
68 | Phosphorylation | IPTVTFSSEKSNTTA CCEEEECCCCCCCHH | 44.87 | 30301811 | |
252 | N-linked_Glycosylation | MNLMLQVNMTSGHSS EEEEEEEECCCCCCC | 18.30 | UniProtKB CARBOHYD | |
258 | Phosphorylation | VNMTSGHSSAPPKET EECCCCCCCCCCCCC | 31.55 | 20068231 | |
259 | Phosphorylation | NMTSGHSSAPPKETS ECCCCCCCCCCCCCH | 38.84 | 20068231 | |
265 | Phosphorylation | SSAPPKETSIGILAA CCCCCCCCHHHHHHH | 31.60 | 26657352 | |
266 | Phosphorylation | SAPPKETSIGILAAA CCCCCCCHHHHHHHH | 21.65 | 26657352 | |
275 | Phosphorylation | GILAAAVSRLEQTPM HHHHHHHHHHHCCCC | 26.82 | 26657352 | |
280 (in isoform 2) | Phosphorylation | - | 16.51 | 24043423 | |
288 (in isoform 2) | Phosphorylation | - | 22.12 | 24043423 | |
290 (in isoform 2) | Phosphorylation | - | 17.32 | 24043423 | |
293 (in isoform 2) | Phosphorylation | - | 15.91 | 24043423 | |
303 (in isoform 2) | Phosphorylation | - | 26.84 | 24043423 | |
377 | Phosphorylation | VQEVLELTKNIVADN HHHHHHHHHHHHCCC | 16.81 | 26074081 | |
392 | Phosphorylation | RVQFHVLSAFDPLPV CEEEEEEECCCCCCC | 26.29 | 26074081 | |
400 | Phosphorylation | AFDPLPVSPSDDKAL CCCCCCCCCCCCHHH | 19.42 | 26074081 | |
402 | Phosphorylation | DPLPVSPSDDKALGY CCCCCCCCCCHHHHH | 51.43 | 26074081 | |
471 | Phosphorylation | HGVNEKISVQAYETQ CCCCCCEEEEEHHHH | 21.17 | 29396449 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of P20D1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of P20D1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of P20D1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of P20D1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...