dbPTM

OSW1_YEAST - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	OSW1_YEAST
UniProt AC	Q08692
Protein Name	Outer spore wall protein 1
Gene Name	OSW1
Organism	Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast).
Sequence Length	278
Subcellular Localization	Spore wall . Predominantly at sites of spore-spore contact.
Protein Description	May be involved in a late step of spore wall assembly..
Protein Sequence	MRAPPSPRKSKSGHFFYLYFRLCQLFSGRKLKRRWHVHKLHIHQYNTRWNLSPLSEIHIEDMINEPSGLCPGSSKKKPLLIARFPKGCQESPRVYVLQRNNLSRLKLSKRKYALRFYHNEIFGNNLKRKDGSIHKVEHQQCAETVRKIKKVTANHADVKIIFHDKNTIRSDKLGGRSNKMQTRPSVLEEDVEEEVSSVYIRFCDDHSLRVKDYHSLHRHSKKSSKEKRNNQEIGKSKLLGKLFEEETSRQNKGVEKKLDTIVIQKFQNYPIVSFSRVI

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference	Orthologous Protein Cluster
Oops, there are no PTM records of OSW1_YEAST !!

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of OSW1_YEAST !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of OSW1_YEAST !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of OSW1_YEAST !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of OSW1_YEAST !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of OSW1_YEAST

Related Literatures of Post-Translational Modification