UniProt ID | OSTCN_HUMAN | |
---|---|---|
UniProt AC | P02818 | |
Protein Name | Osteocalcin | |
Gene Name | BGLAP | |
Organism | Homo sapiens (Human). | |
Sequence Length | 100 | |
Subcellular Localization | Secreted. | |
Protein Description | Constitutes 1-2% of the total bone protein. It binds strongly to apatite and calcium.. | |
Protein Sequence | MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
68 | 4-carboxyglutamate | VPYPDPLEPRREVCE CCCCCCCCCHHHHHH | 41.99 | - | |
68 | Gamma-carboxyglutamic_acid | VPYPDPLEPRREVCE CCCCCCCCCHHHHHH | 41.99 | 6967872 | |
68 | Gamma-carboxyglutamic_acid | VPYPDPLEPRREVCE CCCCCCCCCHHHHHH | 41.99 | 6967872 | |
72 | 4-carboxyglutamate | DPLEPRREVCELNPD CCCCCHHHHHHHCCC | 53.45 | - | |
72 | Gamma-carboxyglutamic_acid | DPLEPRREVCELNPD CCCCCHHHHHHHCCC | 53.45 | 6967872 | |
72 | Gamma-carboxyglutamic_acid | DPLEPRREVCELNPD CCCCCHHHHHHHCCC | 53.45 | 6967872 | |
75 | 4-carboxyglutamate | EPRREVCELNPDCDE CCHHHHHHHCCCHHH | 57.67 | - | |
75 | Gamma-carboxyglutamic_acid | EPRREVCELNPDCDE CCHHHHHHHCCCHHH | 57.67 | 6967872 | |
75 | Gamma-carboxyglutamic_acid | EPRREVCELNPDCDE CCHHHHHHHCCCHHH | 57.67 | 6967872 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OSTCN_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OSTCN_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OSTCN_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OSTCN_HUMAN !! |
Kegg Disease | ||||||
---|---|---|---|---|---|---|
There are no disease associations of PTM sites. | ||||||
OMIM Disease | ||||||
There are no disease associations of PTM sites. | ||||||
Kegg Drug | ||||||
There are no disease associations of PTM sites. | ||||||
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...
Gamma-carboxyglutamic acid | |
Reference | PubMed |
"Isolation and sequence of the vitamin K-dependent protein from humanbone. Undercarboxylation of the first glutamic acid residue."; Poser J.W., Esch F.S., Ling N.C., Price P.A.; J. Biol. Chem. 255:8685-8691(1980). Cited for: PROTEIN SEQUENCE OF 52-100, GAMMA-CARBOXYGLUTAMATION AT GLU-68; GLU-72AND GLU-75, AND ABSENCE OF HYDROXYLATION AT PRO-60. |