UniProt ID | OST48_MOUSE | |
---|---|---|
UniProt AC | O54734 | |
Protein Name | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit | |
Gene Name | Ddost | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 441 | |
Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . |
|
Protein Description | Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Required for the assembly of both SST3A- and SS3B-containing OST complexes. Required for efficient N-glycosylation.. | |
Protein Sequence | MKMDPRLAVRAWPLCGLLLAVLGCVCASGPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIIIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
63 | Phosphorylation | GFELTFKTADDPSLS CCEEEEEECCCCCCE | 31.00 | 22210690 | |
130 | Glutathionylation | LRELGSECGIEFDEE HHHHHHHCCCCCCCC | 7.72 | 24333276 | |
130 | S-palmitoylation | LRELGSECGIEFDEE HHHHHHHCCCCCCCC | 7.72 | 28526873 | |
174 | Ubiquitination | KAPTIVGKSSLNPIL CCCEEECCCCCCCCC | 26.44 | 27667366 | |
174 | Acetylation | KAPTIVGKSSLNPIL CCCEEECCCCCCCCC | 26.44 | 23806337 | |
174 | Succinylation | KAPTIVGKSSLNPIL CCCEEECCCCCCCCC | 26.44 | 23806337 | |
176 | Phosphorylation | PTIVGKSSLNPILFR CEEECCCCCCCCCCE | 35.33 | 28464351 | |
286 | Acetylation | ALSRWVFKEEGVLRV HHHHEEECCCCCEEE | 45.28 | 23806337 | |
286 | Ubiquitination | ALSRWVFKEEGVLRV HHHHEEECCCCCEEE | 45.28 | - | |
286 | Succinylation | ALSRWVFKEEGVLRV HHHHEEECCCCCEEE | 45.28 | 23954790 | |
359 | Acetylation | FLKRKGGKYSVQFKL HHHHCCCEEEEEEEC | 42.92 | 23954790 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OST48_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OST48_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OST48_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OST48_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...