| UniProt ID | OST48_MOUSE | |
|---|---|---|
| UniProt AC | O54734 | |
| Protein Name | Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit | |
| Gene Name | Ddost | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 441 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Single-pass type I membrane protein . |
|
| Protein Description | Essential subunit of the N-oligosaccharyl transferase (OST) complex which catalyzes the transfer of a high mannose oligosaccharide from a lipid-linked oligosaccharide donor to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. Required for the assembly of both SST3A- and SS3B-containing OST complexes. Required for efficient N-glycosylation.. | |
| Protein Sequence | MKMDPRLAVRAWPLCGLLLAVLGCVCASGPRTLVLLDNLNVRDTHSLFFRSLKDRGFELTFKTADDPSLSLIKYGEFLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDVSDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGRNTLLIAGLQARNNARVIFSGSLDFFSDAFFNSAVQKATPGAQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGEMAPPNAYTVTDLVEYSIIIEQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKRKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAFSMMAGLFIFSIVFLHMKEKEKSD | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 63 | Phosphorylation | GFELTFKTADDPSLS CCEEEEEECCCCCCE | 31.00 | 22210690 | |
| 130 | Glutathionylation | LRELGSECGIEFDEE HHHHHHHCCCCCCCC | 7.72 | 24333276 | |
| 130 | S-palmitoylation | LRELGSECGIEFDEE HHHHHHHCCCCCCCC | 7.72 | 28526873 | |
| 174 | Ubiquitination | KAPTIVGKSSLNPIL CCCEEECCCCCCCCC | 26.44 | 27667366 | |
| 174 | Acetylation | KAPTIVGKSSLNPIL CCCEEECCCCCCCCC | 26.44 | 23806337 | |
| 174 | Succinylation | KAPTIVGKSSLNPIL CCCEEECCCCCCCCC | 26.44 | 23806337 | |
| 176 | Phosphorylation | PTIVGKSSLNPILFR CEEECCCCCCCCCCE | 35.33 | 28464351 | |
| 286 | Acetylation | ALSRWVFKEEGVLRV HHHHEEECCCCCEEE | 45.28 | 23806337 | |
| 286 | Ubiquitination | ALSRWVFKEEGVLRV HHHHEEECCCCCEEE | 45.28 | - | |
| 286 | Succinylation | ALSRWVFKEEGVLRV HHHHEEECCCCCEEE | 45.28 | 23954790 | |
| 359 | Acetylation | FLKRKGGKYSVQFKL HHHHCCCEEEEEEEC | 42.92 | 23954790 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OST48_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OST48_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OST48_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of OST48_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
