OSR1_MOUSE - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OSR1_MOUSE
• UniProt AC: Q9WVG7
• Protein Name: Protein odd-skipped-related 1
• Gene Name: Osr1
• Organism: Mus musculus (Mouse).
• Sequence Length: 266
• Subcellular Localization: Nucleus .
• Protein Description: Transcription factor that plays a role in the regulation of embryonic heart and urogenital development..
• Protein Sequence: MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFANLALAATQEDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
116	Asymmetric dimethylarginine	AALKTKPRFDFANLA CCCCCCCCCCHHHHH	45.37	-
116	Methylation	AALKTKPRFDFANLA CCCCCCCCCCHHHHH	45.37	24129315
142	Phosphorylation	GRGEGPGSPAGGLGA CCCCCCCCCCCHHHH	18.08	27180971
154	Phosphorylation	LGALLDVTKLSPEKK HHHHHHHHCCCCCCC	26.40	25777480
157	Phosphorylation	LLDVTKLSPEKKPTR HHHHHCCCCCCCCCC	32.35	29550500

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OSR1_MOUSE !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OSR1_MOUSE !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OSR1_MOUSE !!

Protein-Protein Interaction

Oops, there are no PPI records of OSR1_MOUSE !!

Drug and Disease Associations

• Kegg Drug
• DrugBank
• There are no disease associations of PTM sites.