UniProt ID | OSR1_MOUSE | |
---|---|---|
UniProt AC | Q9WVG7 | |
Protein Name | Protein odd-skipped-related 1 | |
Gene Name | Osr1 | |
Organism | Mus musculus (Mouse). | |
Sequence Length | 266 | |
Subcellular Localization | Nucleus . | |
Protein Description | Transcription factor that plays a role in the regulation of embryonic heart and urogenital development.. | |
Protein Sequence | MGSKTLPAPVPIHPSLQLTNYSFLQAVNGLPTVPSDHLPNLYGFSALHAVHLHQWTLGYPAMHLPRSSFSKVPGAVSSLMDARFQLPAFPWFPHVIHPKPEITAGGSGAALKTKPRFDFANLALAATQEDPTKLGRGEGPGSPAGGLGALLDVTKLSPEKKPTRGRLPSKTKKEFVCKFCGRHFTKSYNLLIHERTHTDERPYTCDICHKAFRRQDHLRDHRYIHSKEKPFKCQECGKGFCQSRTLAVHKTLHSQVKELKTSKIKC | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
|
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
116 | Asymmetric dimethylarginine | AALKTKPRFDFANLA CCCCCCCCCCHHHHH | 45.37 | - | |
116 | Methylation | AALKTKPRFDFANLA CCCCCCCCCCHHHHH | 45.37 | 24129315 | |
142 | Phosphorylation | GRGEGPGSPAGGLGA CCCCCCCCCCCHHHH | 18.08 | 27180971 | |
154 | Phosphorylation | LGALLDVTKLSPEKK HHHHHHHHCCCCCCC | 26.40 | 25777480 | |
157 | Phosphorylation | LLDVTKLSPEKKPTR HHHHHCCCCCCCCCC | 32.35 | 29550500 |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OSR1_MOUSE !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OSR1_MOUSE !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OSR1_MOUSE !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OSR1_MOUSE !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...