dbPTM

ORP3A_ARATH - PTM Information in dbPTM

Basic Information of Protein

Overview of Protein Modification Sites with Functional and Structural Information
UniProt ID	ORP3A_ARATH
UniProt AC	Q9LZM1
Protein Name	Oxysterol-binding protein-related protein 3A
Gene Name	ORP3A
Organism	Arabidopsis thaliana (Mouse-ear cress).
Sequence Length	453
Subcellular Localization	Endoplasmic reticulum . Golgi apparatus . Interaction with PVA12 is necessary for targeting to the ER. Located in the Golgi in the absence of interaction with PVA12.
Protein Description	Oxysterol-binding protein that may be involved in the transport of sterols between the ER and the Golgi. Binds beta-sitosterol. Required for ovule fertilization..
Protein Sequence	MASNDPKNGGGFFASLASSITNFGSAMSKSVNGLMGYEGLEVINPEGSTDDAEEEAGRGRWKQEERDGYWKMMQKYIGSDVTSMVTLPVIIFEPMTMLQKMAELMEYSYLLDMADKTEDPYMRMVYASSWAISVYYAYQRTWKPFNPILGETYEMTNHNGINFIAEQVCHHPPMSAGHAENEHFAYDCTSKLKTKFLGNSIDVYPVGRTRVTLKRDGVVLDLVPPLTKVHNLIFGRTWVDSPGEMVMTNLTTGDKVVLYFQPCGWFGSGRYEVDGYVYNSAEEPKMLMTGKWNESLSYQPCDAEGEPLPGTELKEVWKVAEAPKNDKYQYTHFAHKINSFDTAPKKLLSSDSRLRPDRYALEMGDMSKSGFEKSSLEDRQRAEKKSREEKGQKFAPKWFDETEEVTPTPWGDLEVYQFNGKYSVHRATAENSEDTTDVKLTQFNPWQFQDLSA

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
48	Phosphorylation	EVINPEGSTDDAEEE EEECCCCCCCHHHHH	27.31	23111157
330	Phosphorylation	PKNDKYQYTHFAHKI CCCCCCCCHHHHHHC	10.09	19880383
331	Phosphorylation	KNDKYQYTHFAHKIN CCCCCCCHHHHHHCC	8.59	19880383
339	Phosphorylation	HFAHKINSFDTAPKK HHHHHCCCCCCCCHH	28.15	19880383

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Modified Location	Modified Residue	Modification	Type of Upstream Proteins	Gene Name of Upstream Proteins	UniProt AC of Upstream Proteins	Sources
Oops, there are no upstream regulatory protein records of ORP3A_ARATH !!

Functions of PTM Sites

Modified Location	Modified Residue	Modification	Function	Reference
Oops, there are no descriptions of PTM sites of ORP3A_ARATH !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Modified Location	Modification	Variant Position (Distance <= 10)	Residue Change	SAP	Related Disease	Reference
Oops, there are no SNP-PTM records of ORP3A_ARATH !!

Protein-Protein Interaction

Interacting Protein	Gene Name	Interaction Type	PPI Reference	Domain-Domain Interactions
Oops, there are no PPI records of ORP3A_ARATH !!

Drug and Disease Associations

Kegg Drug
DrugBank
There are no disease associations of PTM sites.

Regulatory Network of ORP3A_ARATH

Related Literatures of Post-Translational Modification