| UniProt ID | ORML2_HUMAN | |
|---|---|---|
| UniProt AC | Q53FV1 | |
| Protein Name | ORM1-like protein 2 | |
| Gene Name | ORMDL2 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 153 | |
| Subcellular Localization |
Endoplasmic reticulum membrane Multi-pass membrane protein . |
|
| Protein Description | Negative regulator of sphingolipid synthesis.. | |
| Protein Sequence | MNVGVAHSEVNPNTRVMNSRGIWLAYIILVGLLHMVLLSIPFFSIPVVWTLTNVIHNLATYVFLHTVKGTPFETPDQGKARLLTHWEQMDYGLQFTSSRKFLSISPIVLYLLASFYTKYDAAHFLINTASLLSVLLPKLPQFHGVRVFGINKY | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 14 | Phosphorylation | HSEVNPNTRVMNSRG CCCCCCCCCCCCHHH | 26.37 | 29052541 | |
| 70 | Phosphorylation | FLHTVKGTPFETPDQ HHHCCCCCCCCCCCC | 21.06 | 21406692 | |
| 74 | Phosphorylation | VKGTPFETPDQGKAR CCCCCCCCCCCCCEE | 32.32 | 21406692 | |
| 79 | Ubiquitination | FETPDQGKARLLTHW CCCCCCCCEEEHHHH | 25.38 | 21906983 | |
| 91 | Phosphorylation | THWEQMDYGLQFTSS HHHHHCCCCCCCCCC | 17.88 | - | |
| 97 | Phosphorylation | DYGLQFTSSRKFLSI CCCCCCCCCCHHHCH | 29.45 | - | |
| 117 | Phosphorylation | YLLASFYTKYDAAHF HHHHHHHHHHHHHHH | 22.55 | 24260401 | |
| 152 | Ubiquitination | VRVFGINKY------ EEEEEEECC------ | 50.87 | 33845483 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORML2_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORML2_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORML2_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ORML2_HUMAN !! | ||||
| Kegg Disease | ||||||
|---|---|---|---|---|---|---|
| There are no disease associations of PTM sites. | ||||||
| OMIM Disease | ||||||
| There are no disease associations of PTM sites. | ||||||
| Kegg Drug | ||||||
| There are no disease associations of PTM sites. | ||||||
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
