| UniProt ID | ORC3_MOUSE | |
|---|---|---|
| UniProt AC | Q9JK30 | |
| Protein Name | Origin recognition complex subunit 3 | |
| Gene Name | Orc3 | |
| Organism | Mus musculus (Mouse). | |
| Sequence Length | 715 | |
| Subcellular Localization | Nucleus. | |
| Protein Description | Component of the origin recognition complex (ORC) that binds origins of replication. DNA-binding is ATP-dependent. The specific DNA sequences that define origins of replication have not been identified yet. ORC is required to assemble the pre-replication complex necessary to initiate DNA replication (By similarity). Binds histone H3 and H4 trimethylation marks H3K9me3, H3K27me3 and H4K20me3 (By similarity).. | |
| Protein Sequence | MHTGPRTMATSSVSKGCFVFKPDFKKRKVFVPIEDYFNNEELDSEDSKLRFETYSLLWQRMKSETEQLQEELNENLFDNLVDFLQKSHPEFQKNSRDWGSQMKFREIPTAALILGVNVTDHDVILRSLTETLQNNVTPYVVSLQAKDCPDVKHFLQKFTSQLMDCCVDRHSKEVTSGKALKKTNYSMDSLCSWYSAVTQKADHKVTIKKRTASGHWRSPPVVLILKSMESFTSKVLQDFITISSQHLHEFPLILIFGIATSPVIIHRLLPHSVSSLLCVELFQSLSCEQHLTVVLDKLLLTPQFPFKLSKKALQVLTNIFLYHDFSIQSFIKGIKLSLLEHFYSQPLSVLCCDLSEAKKRVNVFSVSQCENIRRLPSFRRYVENQPLGKQVALLTNETFLKEKTQSLLEDLHVYHINYFLVLRCLHNFTSSLPKYPLGRQIRELYCTCLEKKIWDSEEYKSALQLLRMLAKDELVSILQRCIEVLDSSTEKQLGNTTQKIKDFLTQFQNLDADSKEEEDACGSQPKGLQKTDLYHLQKSLLEMKELRRTKKPTKFEMLRENVMNFIDNLVRDYLLPPESQPLHEVVYFSAANTLREHLNAAPRIALHTALNNPYYYLKNEELEGCIPNTAPDICIAYKLHLECSLLINLVDWAEAFATVVTAAEKMDANSTVSEEMSEVIHARFIRAVSELELLGFIKPTKQKTDHVARLTWGGC | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 176 | Phosphorylation | RHSKEVTSGKALKKT CCCCCCCCCCCHHHC | 43.39 | 22871156 | |
| 198 | Phosphorylation | CSWYSAVTQKADHKV HHHHHHHHCCCCCEE | 24.86 | - | |
| 476 | Phosphorylation | LAKDELVSILQRCIE HHHHHHHHHHHHHHH | 30.15 | 28382018 | |
| 487 | Phosphorylation | RCIEVLDSSTEKQLG HHHHHHCCCHHHHHC | 34.69 | 28382018 | |
| 488 | Phosphorylation | CIEVLDSSTEKQLGN HHHHHCCCHHHHHCC | 40.01 | 28382018 | |
| 522 (in isoform 2) | Phosphorylation | - | 30.91 | 17525332 | |
| 523 | Phosphorylation | EEEDACGSQPKGLQK HHHHCCCCCCCCCCH | 43.10 | 17525332 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of ORC3_MOUSE !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of ORC3_MOUSE !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of ORC3_MOUSE !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of ORC3_MOUSE !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...
| Phosphorylation | |
| Reference | PubMed |
| "ATM and ATR substrate analysis reveals extensive protein networksresponsive to DNA damage."; Matsuoka S., Ballif B.A., Smogorzewska A., McDonald E.R. III,Hurov K.E., Luo J., Bakalarski C.E., Zhao Z., Solimini N.,Lerenthal Y., Shiloh Y., Gygi S.P., Elledge S.J.; Science 316:1160-1166(2007). Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-523, AND MASSSPECTROMETRY. | |
