OR7G3_HUMAN - PTM Information in dbPTM

Basic Information of Protein

• UniProt ID: OR7G3_HUMAN
• UniProt AC: Q8NG95
• Protein Name: Olfactory receptor 7G3
• Gene Name: OR7G3
• Organism: Homo sapiens (Human).
• Sequence Length: 312
• Subcellular Localization: Cell membrane; Multi-pass membrane protein.
• Protein Description: Odorant receptor..
• Protein Sequence: MKAGNFSDTPEFFLLGLSGDPELQPILFMLFLSMYLATMLGNLLIILAVNSDSHLHTPMYFLLSILSLVDICFTSTTMPKMLVNIQAQAQSINYTGCLTQICFVLVFVGLENGILVMMAYDRFVAICHPLRYNVIMNPKLCGLLLLLSFIVSVLDALLHTLMVLQLTFCIDLEIPHFFCELAHILKLACSDVLINNILVYLVTSLLGVVPLSGIIFSYTRIVSSVMKIPSAGGKYKAFSICGSHLIVVSLFYGTGFGVYLSSGATHSSRKGAIASVMYTVVTPMLNPLIYSLRNKDMLKALRKLISRIPSFH

Overview of Protein Modification Sites with Functional and Structural Information

Experimental Post-Translational Modification Sites

* ASA = Accessible Surface Area

Locations	Modification	Substrate Peptides & Secondary Structure	ASA (%)	Reference
5	N-linked_Glycosylation	---MKAGNFSDTPEF ---CCCCCCCCCCCE	37.80	UniProtKB CARBOHYD
93	N-linked_Glycosylation	QAQAQSINYTGCLTQ HHHHHHCCHHHHHHH	33.29	UniProtKB CARBOHYD
282	Phosphorylation	SVMYTVVTPMLNPLI HHHHHHHHHHHHHHH	9.92	18491316
291	Phosphorylation	MLNPLIYSLRNKDML HHHHHHHHHCCHHHH	17.54	24719451

Upstream regulatory proteins (kinases for phosphorylation sites, E3 ubiquitin ligases of ubiquitination sites, ...)

Oops, there are no upstream regulatory protein records of OR7G3_HUMAN !!

Functions of PTM Sites

Oops, there are no descriptions of PTM sites of OR7G3_HUMAN !!

Disease-associated PTM Sites based on SAP

* Distance = the distance between SAP position and PTM sites.

Oops, there are no SNP-PTM records of OR7G3_HUMAN !!

Protein-Protein Interaction

Oops, there are no PPI records of OR7G3_HUMAN !!

Drug and Disease Associations

• Kegg Disease
• There are no disease associations of PTM sites.
• OMIM Disease
• There are no disease associations of PTM sites.
• Kegg Drug
• There are no disease associations of PTM sites.
• DrugBank
• There are no disease associations of PTM sites.