UniProt ID | OR6T1_HUMAN | |
---|---|---|
UniProt AC | Q8NGN1 | |
Protein Name | Olfactory receptor 6T1 | |
Gene Name | OR6T1 | |
Organism | Homo sapiens (Human). | |
Sequence Length | 323 | |
Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
Protein Description | Odorant receptor.. | |
Protein Sequence | MNPENWTQVTSFVLLGFPSSHLIQFLVFLGLMVTYIVTATGKLLIIVLSWIDQRLHIQMYFFLRNFSFLELLLVTVVVPKMLVVILTGDHTISFVSCIIQSYLYFFLGTTDFFLLAVMSLDRYLAICRPLRYETLMNGHVCSQLVLASWLAGFLWVLCPTVLMASLPFCGPNGIDHFFRDSWPLLRLSCGDTHLLKLVAFMLSTLVLLGSLALTSVSYACILATVLRAPTAAERRKAFSTCASHLTVVVIIYGSSIFLYIRMSEAQSKLLNKGASVLSCIITPLLNPFIFTLRNDKVQQALREALGWPRLTAVMKLRVTSQRK | |
Overview of Protein Modification Sites with Functional and Structural Information | ||
* ASA = Accessible Surface Area
Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
---|---|---|---|---|---|
5 | N-linked_Glycosylation | ---MNPENWTQVTSF ---CCCCHHHHHHHH | 48.64 | UniProtKB CARBOHYD | |
214 | Phosphorylation | LLGSLALTSVSYACI HHHHHHHHHHHHHHH | 22.83 | - | |
215 | Phosphorylation | LGSLALTSVSYACIL HHHHHHHHHHHHHHH | 15.20 | - | |
238 | Ubiquitination | AAERRKAFSTCASHL HHHHHHHHHHHHHHC | 7.53 | 22505724 | |
259 | Phosphorylation | YGSSIFLYIRMSEAQ ECCCHHHHHHCHHHH | 3.92 | - | |
291 | Phosphorylation | LLNPFIFTLRNDKVQ HCCCHHHHCCCHHHH | 21.71 | 24719451 | |
296 | Ubiquitination | IFTLRNDKVQQALRE HHHCCCHHHHHHHHH | 45.55 | 22505724 | |
311 | Phosphorylation | ALGWPRLTAVMKLRV HHCCCHHHHHHHHHH | 20.63 | - |
Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OR6T1_HUMAN !! |
Modified Location | Modified Residue | Modification | Function | Reference | ||
---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OR6T1_HUMAN !! |
* Distance = the distance between SAP position and PTM sites.
Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OR6T1_HUMAN !! |
Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
---|---|---|---|---|
Oops, there are no PPI records of OR6T1_HUMAN !! |
Kegg Drug | ||||||
---|---|---|---|---|---|---|
DrugBank | ||||||
There are no disease associations of PTM sites. |
loading...