| UniProt ID | OR4X1_HUMAN | |
|---|---|---|
| UniProt AC | Q8NH49 | |
| Protein Name | Olfactory receptor 4X1 | |
| Gene Name | OR4X1 | |
| Organism | Homo sapiens (Human). | |
| Sequence Length | 305 | |
| Subcellular Localization |
Cell membrane Multi-pass membrane protein. |
|
| Protein Description | Odorant receptor.. | |
| Protein Sequence | MVATNNVTEIIFVGFSQNWSEQRVISVMFLLMYTAVVLGNGLIVVTILASKVLTSPMYFFLSYLSFVEICYCSVMAPKLIFDSFIKRKVISLKGCLTQMFSLHFFGGTEAFLLMVMAYDRYVAICKPLHYMAIMNQRMCGLLVRIAWGGGLLHSVGQTFLIFQLPFCGPNIMDHYFCDVHPVLELACADTFFISLLIITNGGSISVVSFFVLMASYLIILHFLRSHNLEGQHKALSTCASHVTVVDLFFIPCSLVYIRPCVTLPADKIVAVFYTVVTPLLNPVIYSFRNAEVKNAMRRFIGGKVI | |
| Overview of Protein Modification Sites with Functional and Structural Information | ||
|
|
||
* ASA = Accessible Surface Area
| Locations | Modification | Substrate Peptides & Secondary Structure |
ASA (%) | Reference | Orthologous Protein Cluster |
|---|---|---|---|---|---|
| 6 | N-linked_Glycosylation | --MVATNNVTEIIFV --CCCCCCEEEEEEE | 37.42 | UniProtKB CARBOHYD | |
| 18 | N-linked_Glycosylation | IFVGFSQNWSEQRVI EEEECCCCCCHHHHH | 42.94 | UniProtKB CARBOHYD | |
| 83 | Phosphorylation | APKLIFDSFIKRKVI CCHHHHHHHHHHHHH | 20.37 | 24719451 | |
| 86 | Ubiquitination | LIFDSFIKRKVISLK HHHHHHHHHHHHCHH | 44.12 | 32015554 | |
| 91 | Phosphorylation | FIKRKVISLKGCLTQ HHHHHHHCHHHHHHH | 27.32 | 24719451 |
| Modified Location | Modified Residue | Modification | Type of Upstream Proteins | Gene Name of Upstream Proteins | UniProt AC of Upstream Proteins | Sources |
|---|---|---|---|---|---|---|
Oops, there are no upstream regulatory protein records of OR4X1_HUMAN !! | ||||||
| Modified Location | Modified Residue | Modification | Function | Reference | ||
|---|---|---|---|---|---|---|
Oops, there are no descriptions of PTM sites of OR4X1_HUMAN !! | ||||||
* Distance = the distance between SAP position and PTM sites.
| Modified Location | Modification | Variant Position (Distance <= 10) |
Residue Change | SAP | Related Disease | Reference |
|---|---|---|---|---|---|---|
Oops, there are no SNP-PTM records of OR4X1_HUMAN !! | ||||||
| Interacting Protein | Gene Name | Interaction Type | PPI Reference | Domain-Domain Interactions |
|---|---|---|---|---|
Oops, there are no PPI records of OR4X1_HUMAN !! | ||||
| Kegg Drug | ||||||
|---|---|---|---|---|---|---|
| DrugBank | ||||||
| There are no disease associations of PTM sites. | ||||||
loading...